6LW5: Human formyl peptide receptor 2

Crystal structure of the human formyl peptide receptor 2 in complex with WKYMVm. Determined by X-ray diffraction at 2.8 Å resolution. Released 25 Mar 2020.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Escherichia coli, Homo sapiens, synthetic construct
Chains: 2
Atoms: 3,446
Mol. weight: 49.32 kDa
Ligands: CLR
Released: 25 Mar 2020

Explore 6LW5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LW5 contains 24 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	1003-1019	17
α-helix	1024-1042	19
α-helix	1061-1080	20
α-helix	1084-6	27
α-helix	15-17	3
α-helix	20-49	30
α-helix	50-54	5
α-helix	59-75	17
α-helix	78-86	9
β-strand	90	1	1
α-helix	95-128	34
α-helix	130-136	7
α-helix	139-145	7
α-helix	147-155	9
α-helix	158-163	6
β-strand	164-168	5	1
β-strand	174-178	5	1
α-helix	180-182	3
α-helix	187-206	20
α-helix	207-211	5
α-helix	212-230	19
α-helix	240-266	27
α-helix	268-273	6
α-helix	278-282	5
α-helix	284-298	15
α-helix	299-303	5
α-helix	307-316	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Soluble cytochrome b562,N-formyl peptide receptor 2	A	protein	427	Escherichia coli, Homo sapiens	P0ABE7 (AlphaFold model), P25090 (AlphaFold model)
Trp-lys-tyr-met-val-qxv	B	protein	6	synthetic construct

Sequence of entity 1 (A), FASTA

>6LW5_1 Soluble cytochrome b562,N-formyl peptide receptor 2 (chains A)
PADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMK
DFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLTNFSTPLNEYEEV
SYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFT
ATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQN
HRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAI
TMLTARGIIRFVIGFLLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWF
PFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIH
SLPTSLE

Sequence of entity 2 (B), FASTA

>6LW5_2 TRP-LYS-TYR-MET-VAL-QXV (chains B)
WKYMVX

Ligands and cofactors

ID	Name	Formula	Copies
CLR	Cholesterol	C27 H46 O	2

Primary citation

Structural basis of ligand binding modes at the human formyl peptide receptor 2. Chen, T., Xiong, M., Zong, X. et al. Nat Commun (2020) 11:1208-1208. DOI 10.1038/s41467-020-15009-1 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 6LW5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.