6M8R: KCTD16 BTB domain

Crystal structure of the KCTD16 BTB domain in complex with GABAB2 peptide. Determined by X-ray diffraction at 3.2 Å resolution. Released 27 Feb 2019.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 12
Atoms: 8,578
Mol. weight: 131.29 kDa
Ligands: MG
Released: 27 Feb 2019

Explore 6M8R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6M8R contains 63 α-helices and 42 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	9
β-strand	34-39	6	9
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	9
β-strand	73-75	3	9
α-helix	82-91	10
α-helix	96-97	2
α-helix	103-112	10
α-helix	116-122	7

Chain B: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	5
β-strand	34-39	6	5
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	5
β-strand	73-75	3	5
α-helix	79-91	13
α-helix	96-97	2
α-helix	103-112	10
α-helix	116-122	7

Chains C, D, G and H: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	6
β-strand	34-39	6	6
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	6
β-strand	73-75	3	6
α-helix	79-91	13
α-helix	95-97	3
α-helix	103-112	10
α-helix	116-122	7

Chain E: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	8
β-strand	34-39	6	8
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	8
β-strand	73-75	3	8
α-helix	79-91	13
α-helix	103-112	10
α-helix	116-122	7

Chain F: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	10
β-strand	34-39	6	10
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	10
β-strand	73-75	3	10
α-helix	82-91	10
α-helix	103-113	11
α-helix	116-122	7

Chains I and J: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	3
β-strand	34-39	6	3
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	3
β-strand	73-75	3	3
α-helix	82-91	10
α-helix	95-97	3
α-helix	103-112	10
α-helix	116-122	7

Chain K: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	885-890	6
α-helix	899-902	4
β-strand	910-911	2	1
α-helix	912	1

Chain L: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	885-890	6
α-helix	899-903	5
β-strand	910-911	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BTB/POZ domain-containing protein KCTD16	A, B, C, D, E, F, G, H, I, J	protein	103	Homo sapiens	Q68DU8 (AlphaFold model)
Gamma-aminobutyric acid type B receptor subunit 2	K, L	protein	41	Homo sapiens	O75899 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA

>6M8R_1 BTB/POZ domain-containing protein KCTD16 (chains A, B, C, D, E, F, G, H, I, J)
MFPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSPKRDTANDLAKDSKGRFFIDRDGFL
FRYILDYLRDRQVVLPDHFPEKGRLKREAEYFQLPDLVKLLTP

Sequence of entity 2 (K, L), FASTA

>6M8R_2 Gamma-aminobutyric acid type B receptor subunit 2 (chains K, L)
GPEKDPIEDINSPEHIQRRLSLQLPILHHAYLPSIGGVDAS

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2

Primary citation

Structural basis for KCTD-mediated rapid desensitization of GABABsignalling. Zheng, S., Abreu, N., Levitz, J. et al. Nature (2019) 567:127-131. DOI 10.1038/s41586-019-0990-0 · PubMed

Other PDB entries of the same protein (UniProt Q68DU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QB7 2.23 Å, Structure of the H1 domain of human KCTD16
6OCR 2.28 Å, Crystal structure of human KCTD16 T1 domain
6I0Q 2.3 Å, Crystal structure of BTB domain of KCTD16 hexamer
6OCP 2.35 Å, Crystal structure of a human GABAB receptor peptide bound to KCTD16 T1
5A15 2.76 Å, Crystal structure of the BTB domain of human KCTD16
6OCT 2.8 Å, Crystal structure of human KCTD16 T1 domain

Browse structure collections

About this viewer

MolViewer shows 6M8R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.