6MHG: Circumsporozoite protein

Cryo-EM structure of the circumsporozoite protein of Plasmodium falciparum with a vaccine-elicited antibody reveals maturation of inter-antibody contacts. Determined by electron microscopy at 3.57 Å resolution. Released 31 Oct 2018.

Method: Electron microscopy
Resolution: 3.57 Å
Organisms: Plasmodium falciparum, Homo sapiens
Chains: 23
Atoms: 19,931
Mol. weight: 548.11 kDa
Released: 31 Oct 2018

Explore 6MHG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MHG contains 56 α-helices and 287 β-strands across 22 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	10-12	3	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	34-39	6	8
β-strand	46-51	6	8
β-strand	57-59	3	8
β-strand	64	1	7
β-strand	67-72	6	7
β-strand	77-82	6	7
α-helix	84-86	3
β-strand	88-97	10	8
β-strand	100B-103	6	8
β-strand	107-111	5	8

Chains B, D, F, H, I, J and K: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	13
β-strand	10-12	3	14
β-strand	18-25	8	13
α-helix	29-31	3
β-strand	34-39	6	14
β-strand	46-51	6	14
β-strand	57-59	3	14
β-strand	64	1	13
β-strand	67-72	6	13
α-helix	73-75	3
β-strand	77-82	6	13
α-helix	84-86	3
β-strand	88-97	10	14
β-strand	100B-103	6	14
β-strand	107-111	5	14

Chains C and G: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	19
β-strand	10-12	3	20
β-strand	18-25	8	19
α-helix	29-31	3
β-strand	34-39	6	20
β-strand	46-51	6	20
β-strand	57-59	3	20
α-helix	61-63	3
β-strand	64	1	19
β-strand	67-72	6	19
α-helix	73-75	3
β-strand	77-82	6	19
α-helix	84-86	3
β-strand	88-97	10	20
β-strand	100B-103	6	20
β-strand	107-111	5	20

Chain L: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	3
β-strand	5	1	4
β-strand	9-13	4	5
β-strand	19-24	6	4
α-helix	31-33	3
β-strand	34-38	5	5
β-strand	44-48	5	5
β-strand	49	1	6
β-strand	53	1	6
β-strand	62-67	6	4
β-strand	70-75	6	4
α-helix	80-82	3
β-strand	84-91	8	5
β-strand	96-98	3	5
β-strand	99	1	3
β-strand	102-106	5	5

Chain M: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	61
β-strand	10-12	3	62
β-strand	18-25	8	61
α-helix	29-31	3
β-strand	34-39	6	62
α-helix	45	1
β-strand	46-51	6	62
β-strand	57-59	3	62
β-strand	64	1	61
β-strand	67-72	6	61
β-strand	77-82	6	61
α-helix	84-86	3
β-strand	88-97	10	62
β-strand	100B-103	6	62
β-strand	107-111	5	62

Chains N, P, Q, R, S and V: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	9
β-strand	5	1	10
β-strand	9-13	4	11
β-strand	19-24	6	10
α-helix	31-33	3
β-strand	34-38	5	11
β-strand	45-48	4	11
β-strand	49	1	12
β-strand	53	1	12
β-strand	62-67	6	10
β-strand	70-75	6	10
α-helix	80-82	3
β-strand	84-90	7	11
β-strand	97-98	2	11
β-strand	99	1	9
β-strand	102-106	5	11

Chain O: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	15
β-strand	5	1	16
β-strand	9-13	4	17
β-strand	19-24	6	16
α-helix	31-33	3
β-strand	34-38	5	17
β-strand	44-48	5	17
β-strand	49	1	18
β-strand	53	1	18
β-strand	62-67	6	16
β-strand	70-75	6	16
α-helix	80-82	3
β-strand	84-90	7	17
β-strand	97-98	2	17
β-strand	99	1	15
β-strand	102-106	5	17

Chain T: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	45
β-strand	5	1	46
β-strand	9-13	4	47
β-strand	19-24	6	46
α-helix	31-33	3
β-strand	34-38	5	47
β-strand	45-48	4	47
β-strand	49	1	48
β-strand	53	1	48
α-helix	54-55	2
β-strand	62-67	6	46
β-strand	70-75	6	46
α-helix	80-82	3
β-strand	84-90	7	47
β-strand	97-98	2	47
β-strand	99	1	45
β-strand	102-106	5	47

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
circumsporozoite protein	E	protein	278	Plasmodium falciparum	Q7K740 (AlphaFold model)
Fab311 heavy chain	A, B, C, D, F, G, H, I, J, K, M	protein	225	Homo sapiens	V9HW68 (AlphaFold model)
Fab311 light chain	L, N, O, P, Q, R, S, T, U, V, W	protein	218	Homo sapiens

Sequence of entity 1 (E), FASTA

>6MHG_1 circumsporozoite protein (chains E)
YGSSSNTRVLNELNYDNAGTNLYNELEMNYYGKQENWYSLKKNSRSLGENDDGNNEDNEK
LRKPKHKKLKQPADGNPDPNANPNVDPNANPNVDPNANPNVDPNANPNANPNANPNANPN
ANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNKNNQGNGQGHNM
PNDPNRNVDENANANSAVKNNNNEEPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVR
IKPGSANKPKDELDYANDIEKKICKMEKCSSVFNVVNS

Sequence of entity 2 (A, B, C, D, F, G, H, I, J, K, M), FASTA

>6MHG_2 Fab311 heavy chain (chains A, B, C, D, F, G, H, I, J, K, M)
EVQLVESGGGVVPPGRSLRLSCATSGFTFSNYGMHWVRQAPGKGLEWVAIIWYDGSRNFY
AASVEGRFTISRDNSKNTLYLQMNSLRVEDTAVYYCARAAYYDTSGYGDYWGQGTLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD

Sequence of entity 3 (L, N, O, P, Q, R, S, T, U, V, W), FASTA

>6MHG_3 Fab311 light chain (chains L, N, O, P, Q, R, S, T, U, V, W)
ESVLTQPPSVSGAPGQTVTISCTGGSSNIGAGYDVHWYQQLPGTAPKLLIYGNINRPSGV
PDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDRRLSGSWVFGGGTKLTVLGQPKAAPS
VTLFPPSSEELQANKATLVCLVSDFYPGAVTVAWKADGSPVKVGVETTKPSKQSNNKYAA
SSYLSLTPEQWKSHRSYSCRVTHEGSTVEKTVAPAECS

Primary citation

Cryo-EM structure ofP. falciparumcircumsporozoite protein with a vaccine-elicited antibody is stabilized by somatically mutated inter-Fab contacts. Oyen, D., Torres, J.L., Cottrell, C.A. et al. Sci Adv (2018) 4:eaau8529-eaau8529. DOI 10.1126/sciadv.aau8529 · PubMed

Other PDB entries of the same protein (UniProt Q7K740 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SG5 1.4 Å, Structure of PfCSP peptide 21 with antibody CIS43_Var2
9C79 1.46 Å, Human monoclonal antibody MAD21-101 bound to the N-terminus of cleaved circumsporozoite…
9NKZ 1.48 Å, Crystal structure of Fab MAM01 in complex with NANP6 peptide from circumsporozoite protein
9NL0 1.54 Å, Crystal structure of Fab MAM01 in complex with NPNA3 peptide from circumsporozoite protein
7SG6 1.55 Å, Structure of PfCSP peptide 21 with antibody CIS43_Var10
6PBV 1.57 Å, Crystal structure of Fab668 complex
9NCY 1.63 Å, Fab1392 in complex with the C-terminal alpha-TSR domain of the P. falciparum…
3VDJ 1.7 Å, Crystal structure of circumsporozoite protein aTSR domain, R32 native form
9DST 1.74 Å, Crystal structure of Fab MS-1805 in complex with N-terminal junction peptide from…
9NI1 1.75 Å, Fab389 in complex with the C-terminal alpha-TSR domain of the P. falciparum…
7RXP 1.76 Å, Fab1512 in complex with the C-terminal alpha-TSR domain of P. falciparum
6BQB 1.77 Å, MGG4 Fab in complex with peptide

Browse structure collections

About this viewer

MolViewer shows 6MHG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.