6N5M: ABIN-1 UBAN

Crystal structure of ABIN-1 UBAN in complex with one M1-linked di-ubiquitin. Determined by X-ray diffraction at 3.01 Å resolution. Released 17 Jul 2019.

Method: X-ray diffraction
Resolution: 3.01 Å
Organism: Mus musculus
Chains: 3
Atoms: 2,277
Mol. weight: 34.86 kDa
Released: 17 Jul 2019

Explore 6N5M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6N5M contains 8 α-helices and 14 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	1-7	7	1
β-strand	12-17	6	1
β-strand	22	1	2
α-helix	23-33	11
α-helix	38-40	3
β-strand	41-45	5	1
β-strand	48-49	2	1
β-strand	55	1	2
β-strand	66-71	6	1
α-helix	72	1
β-strand	77-83	7	3
α-helix	87	1
β-strand	88-93	6	3
β-strand	98	1	4
α-helix	99-110	12
α-helix	114-116	3
β-strand	117-121	5	3
β-strand	124-125	2	3
β-strand	131	1	4
β-strand	142-147	6	3

Chains B and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	466-522	57

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polyubiquitin-C	A	protein	157	Mus musculus	P0CG50 (AlphaFold model)
TNFAIP3-interacting protein 1	B, D	protein	72	Mus musculus	Q9WUU8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6N5M_1 Polyubiquitin-C (chains A)
GSGSGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPD
QQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG

Sequence of entity 2 (B, D), FASTA

>6N5M_2 TNFAIP3-interacting protein 1 (chains B, D)
GSLRKQELVTQNELLKQQVKIFEEDFQRERSDRERMNEEKEELKKQVEKLQAQVTLTNAQ
LKTLKEEEKAKE

Primary citation

Molecular Recognition of M1-Linked Ubiquitin Chains by Native and Phosphorylated UBAN Domains. Herhaus, L., van den Bedem, H., Tang, S. et al. J Mol Biol (2019) 431:3146-3156. DOI 10.1016/j.jmb.2019.06.012 · PubMed

Other PDB entries of the same protein (UniProt P0CG50 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3A9J 1.18 Å, Crystal structure of the mouse TAB2-NZF in complex with Lys63-linked di-ubiquitin
3A9K 1.4 Å, Crystal structure of the mouse TAB3-NZF in complex with Lys63-linked di-ubiquitin
2ZNV 1.6 Å, Crystal structure of human AMSH-LP DUB domain in complex with Lys63-linked ubiquitin dimer
3WWQ 1.9 Å, Crystal structure of FAAP20 UBZ domain in complex with Lys63-linked diubiquitin
3A1Q 2.2 Å, Crystal structure of the mouse RAP80 UIMs in complex with Lys63-linked di-ubiquitin
4NQL 2.3 Å, The crystal structure of the DUB domain of AMSH orthologue, Sst2 from S. pombe, in…
3WXG 3.1 Å, Crystal structure of CYLD USP domain (C596A) in complex with Lys63-linked diubiquitin
9T67 7.7 Å, Cytoplasmic lattice filament repeat unit with ubiquitin
9T68 8.0 Å, Composite structure of the repeat unit of cytoplasmic lattice filament

Browse structure collections

About this viewer

MolViewer shows 6N5M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.