6N8P: Lethal giant larvae protein homolog 2

Crystal structure of the human cell polarity protein Lethal Giant Larvae 2 (Lgl2). Unphosphorylated, crystal form 1. Determined by X-ray diffraction at 3.19 Å resolution. Released 8 May 2019.

Method: X-ray diffraction
Resolution: 3.19 Å
Organism: Homo sapiens
Chains: 1
Atoms: 6,453
Mol. weight: 109.31 kDa
Released: 8 May 2019

Explore 6N8P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6N8P contains 20 α-helices and 69 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 69 β-strands

Element	Residues	Length	Sheet
β-strand	24-30	7	1
α-helix	32	1
β-strand	35-41	7	2
β-strand	46-51	6	2
β-strand	55-59	5	2
β-strand	65-69	5	2
β-strand	76-81	6	3
α-helix	82	1
β-strand	87-92	6	3
β-strand	96-104	9	3
β-strand	109-118	10	3
α-helix	127-130	4
β-strand	132-137	6	4
β-strand	143-148	6	4
β-strand	153-157	5	4
β-strand	162-169	8	4
α-helix	171-175	5
α-helix	180-182	3
β-strand	191-197	7	5
β-strand	200-208	9	5
β-strand	212-217	6	5
β-strand	222-228	7	5
β-strand	233-238	6	6
β-strand	244-249	6	6
β-strand	254-258	5	6
β-strand	260	1	7
β-strand	263	1	7
β-strand	270-272	3	6
β-strand	280	1	8
β-strand	283-289	7	9
β-strand	297-302	6	9
β-strand	305	1	8
α-helix	309-311	3
β-strand	313-319	7	9
β-strand	322-328	7	9
β-strand	332-339	8	10
β-strand	350-357	8	10
β-strand	361-365	5	10
α-helix	372	1
β-strand	373	1	10
α-helix	374-376	3
β-strand	387-393	7	11
α-helix	398-410	13
β-strand	426-427	2	12
β-strand	437-442	6	11
β-strand	446-451	6	11
β-strand	458-464	7	11
α-helix	465-468	4
β-strand	469	1	13
β-strand	490-492	3	9
α-helix	503-505	3
β-strand	507-512	6	14
β-strand	518-523	6	14
β-strand	527-534	8	14
β-strand	538-540	3	15
β-strand	543-548	6	14
β-strand	566	1	13
α-helix	570	1
β-strand	571-573	3	15
β-strand	576-586	11	14
α-helix	589-591	3
β-strand	593-597	5	16
β-strand	602-606	5	16
β-strand	610-615	6	16
β-strand	620-626	7	16
β-strand	713-721	9	17
β-strand	730-737	8	17
β-strand	741-748	8	17
α-helix	749-751	3
α-helix	752-754	3
β-strand	761-769	9	17
β-strand	776-782	7	18
α-helix	787	1
β-strand	788	1	18
α-helix	789-791	3
α-helix	799-801	3
β-strand	810-815	6	18
β-strand	818-823	6	18
β-strand	828-834	7	18
α-helix	835-839	5
β-strand	843-850	8	19
β-strand	862-868	7	19
β-strand	873-877	5	19
β-strand	883-886	4	19
α-helix	895-899	5
β-strand	901-903	3	1
β-strand	908-914	7	1
β-strand	917-922	6	1
β-strand	933-934	2	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lethal(2) giant larvae protein homolog 2	A	protein	979	Homo sapiens	Q6P1M3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6N8P_1 Lethal(2) giant larvae protein homolog 2 (chains A)
MRERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLHQ
ENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASELQEDESFTLRGPPGAAPSATQ
ITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMV
EALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWWQRDGRLLVSCHSD
GSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGLPFTIFQGGMPRASYGD
RHCISVIHDGQQTAFDFTSRVIGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGW
PPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQNAHFSTMEWPIDGGTSLTPA
PPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDPNENFSAQGEDEWPPLR
KVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEQAVEQVEADLLQ
DQEGYRWKGHERLAARSGPVRFEPGFQPFVLVQCQPPAVVTSLALHSEWRLVAFGTSHGF
GLFDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLRQSFRRMRRSRVSSRKRHPAG
PPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLKDSSRHCP
SLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGILVLDGHSVPLPE
PLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTALEGSRVRRVSVAHF
GSRRAEDYGEHHLAVLTNLGDIQVVSLPLLKPQVRYSCIRREDVSGIASCVFTKYGQGFY
LISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARNSGTQSDGEEKQ
PGLVMEREFTTASENLYFQ

Primary citation

Structural insights into the aPKC regulatory switch mechanism of the human cell polarity protein lethal giant larvae 2. Almagor, L., Ufimtsev, I.S., Ayer, A. et al. Proc Natl Acad Sci U S A (2019) 116:10804-10812. DOI 10.1073/pnas.1821514116 · PubMed

Other PDB entries of the same protein (UniProt Q6P1M3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6N8R 1.91 Å, Crystal structure of the human cell polarity protein Lethal Giant Larvae 2 (Lgl2). aPKC…
3WP0 2.04 Å, Crystal structure of Dlg GK in complex with a phosphor-Lgl2 peptide
6N8Q 2.2 Å, Crystal structure of the human cell polarity protein Lethal Giant Larvae 2 (Lgl2).…
8R3X 2.59 Å, Crystal structure of aPKC Iota kinase domain with LLGL2 peptide
3WP1 2.8 Å, Phosphorylation-dependent interaction between tumor suppressors Dlg and Lgl
9EJK 3.08 Å, Lgl2 bound to the aPKCiota-Par6b complex in nucleotide-free form. Head sub-complex…
9EJM 3.33 Å, Lgl2 bound to the aPKCiota-Par6B complex in its ADP-bound form
9EJL 3.48 Å, Lgl2 bound to the aPKCiota-Par6B complex in nucleotide-free form. Conformation with…
6N8S 3.9 Å, Crystal structure of the human cell polarity protein Lethal Giant Larvae 2 (Lgl2). aPKC…

Browse structure collections

About this viewer

MolViewer shows 6N8P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.