Crystal structure of Dlg GK in complex with a phosphor-Lgl2 peptide. Determined by X-ray diffraction at 2.04 Å resolution. Released 19 Mar 2014.
Explore 3WP0 in 3D Show helices and sheets RCSB PDB PDBe
3WP0 contains 12 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 534-536 | 3 | |
| β-strand | 537-540 | 4 | 1 |
| α-helix | 544-554 | 11 | |
| β-strand | 559-560 | 2 | 2 |
| α-helix | 562-564 | 3 | |
| β-strand | 565-566 | 2 | 3 |
| α-helix | 569-570 | 2 | |
| β-strand | 576 | 1 | 4 |
| β-strand | 580 | 1 | 4 |
| β-strand | 581-582 | 2 | 3 |
| α-helix | 586-594 | 9 | |
| β-strand | 598-604 | 7 | 3 |
| β-strand | 607-612 | 6 | 3 |
| α-helix | 613-621 | 9 | |
| β-strand | 625-626 | 2 | 2 |
| β-strand | 627-628 | 2 | 1 |
| α-helix | 633-640 | 8 | |
| β-strand | 646-650 | 5 | 1 |
| α-helix | 655-661 | 7 | |
| α-helix | 667-684 | 18 | |
| α-helix | 685-687 | 3 | |
| β-strand | 690-692 | 3 | 1 |
| α-helix | 697-710 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 575-579 | 5 | |
| β-strand | 583 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Disks large homolog 4 | A | protein | 187 | Rattus norvegicus | P31016 (AlphaFold model) |
| Lethal(2) giant larvae protein homolog 2 | B | protein | 15 | Homo sapiens | Q6P1M3 (AlphaFold model) |
>3WP0_1 Disks large homolog 4 (chains A) GPGSVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSR EKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPI AIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKR VIEDLSG
>3WP0_2 Lethal(2) giant larvae protein homolog 2 (chains B) LSRVKSLKKSLRQSF
Phosphorylation-dependent interaction between tumor suppressors Dlg and Lgl. Zhu, J., Shang, Y., Wan, Q. et al. Cell Res (2014) 24:451-463. DOI 10.1038/cr.2014.16 · PubMed
Other PDB entries of the same protein (UniProt P31016 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3WP0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.