6NHW: PDB entry 6NHW
Structure of the transmembrane domain of the Death Receptor 5 - Dimer of Trimer. Determined by solution NMR. Released 27 Feb 2019.
- Method
- Solution NMR
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 1,566
- Mol. weight
- 22.35 kDa
- Released
- 27 Feb 2019
Explore 6NHW in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6NHW contains 9 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 211-213 | 3 | |
| α-helix | 214-236 | 23 | |
Chain B: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 211-213 | 3 | |
| α-helix | 214-234 | 21 | |
Chain C: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 211-213 | 3 | |
| α-helix | 215-234 | 20 | |
Chain D: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 211-236 | 26 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 211-232 | 22 | |
Chain F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 211-234 | 24 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Tumor necrosis factor receptor superfamily member 10B | A, B, C, D, E, F | protein | 36 | Homo sapiens | O14763 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>6NHW_1 Tumor necrosis factor receptor superfamily member 10B (chains A, B, C, D, E, F)
MPGSLSGIIIGVTVAAVVLIVAVFVCKSLLWKKVLP
Primary citation
Higher-Order Clustering of the Transmembrane Anchor of DR5 Drives Signaling. Pan, L., Fu, T.M., Zhao, W. et al. Cell (2019) 176:1477-1489.e14. DOI 10.1016/j.cell.2019.02.001 · PubMed
Other PDB entries of the same protein (UniProt O14763 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3X3F 2.1 Å, TRAIL-R2 Extracellular Region Complexed to a Fab fragment from Human Agonist Antibody…
- 4I9X 2.1 Å, Crystal structure of human cytomegalovirus glycoprotein UL141 targeting the death…
- 1D4V 2.2 Å, Crystal structure of trail-DR5 complex
- 1DU3 2.2 Å, Crystal structure of TRAIL-SDR5
- 2H9G 2.32 Å, Crystal structure of phage derived Fab BdF1 with human Death Receptor 5 (DR5)
- 1D0G 2.4 Å, Crystal structure of death receptor 5 (DR5) bound to APO2L/TRAIL
- 6T3J 3.05 Å, Dual Epitope Targeting by Anti-DR5 Antibodies
- 4OD2 3.2 Å, Crystal structure of the Fab fragment of an anti-DR5 antibody bound to DR5
- 4N90 3.3 Å, Crystal structure of ternary complex of TRAIL, DR5, and Fab fragment from a DR5 agonist…
- 1ZA3 3.35 Å, The crystal structure of the YSd1 Fab bound to DR5
- 6NHY Structure of the transmembrane domain of the Death Receptor 5 mutant (G217Y) - Trimer Only
- 8DPX Preligand association structure of DR5
Browse structure collections
About this viewer
MolViewer shows 6NHW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.