6NHY: PDB entry 6NHY

Structure of the transmembrane domain of the Death Receptor 5 mutant (G217Y) - Trimer Only. Determined by solution NMR. Released 27 Feb 2019.

Method: Solution NMR
Organism: Homo sapiens
Chains: 3
Atoms: 807
Mol. weight: 11.5 kDa
Released: 27 Feb 2019

Explore 6NHY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6NHY contains 3 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	211-236	26

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	212-236	25

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	211-237	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor receptor superfamily member 10B	A, B, C	protein	36	Homo sapiens	O14763 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>6NHY_1 Tumor necrosis factor receptor superfamily member 10B (chains A, B, C)
MPGSLSGIIIYVTVAAVVLIVAVFVCKSLLWKKVLP

Primary citation

Higher-Order Clustering of the Transmembrane Anchor of DR5 Drives Signaling. Pan, L., Fu, T.M., Zhao, W. et al. Cell (2019) 176:1477-1489.e14. DOI 10.1016/j.cell.2019.02.001 · PubMed

Other PDB entries of the same protein (UniProt O14763 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3X3F 2.1 Å, TRAIL-R2 Extracellular Region Complexed to a Fab fragment from Human Agonist Antibody…
4I9X 2.1 Å, Crystal structure of human cytomegalovirus glycoprotein UL141 targeting the death…
1D4V 2.2 Å, Crystal structure of trail-DR5 complex
1DU3 2.2 Å, Crystal structure of TRAIL-SDR5
2H9G 2.32 Å, Crystal structure of phage derived Fab BdF1 with human Death Receptor 5 (DR5)
1D0G 2.4 Å, Crystal structure of death receptor 5 (DR5) bound to APO2L/TRAIL
6T3J 3.05 Å, Dual Epitope Targeting by Anti-DR5 Antibodies
4OD2 3.2 Å, Crystal structure of the Fab fragment of an anti-DR5 antibody bound to DR5
4N90 3.3 Å, Crystal structure of ternary complex of TRAIL, DR5, and Fab fragment from a DR5 agonist…
1ZA3 3.35 Å, The crystal structure of the YSd1 Fab bound to DR5
6NHW Structure of the transmembrane domain of the Death Receptor 5 - Dimer of Trimer
8DPX Preligand association structure of DR5

Browse structure collections

About this viewer

MolViewer shows 6NHY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.