Crystal structure of de novo designed metal-controlled dimer of mutant B1 immunoglobulin-binding domain of Streptococcal Protein G (L12H, T16L, V29H, Y33H, N37L)-zinc. Determined by X-ray diffraction at 1.5 Å resolution. Released 23 Jan 2019.
Explore 6NL8 in 3D Show helices and sheets RCSB PDB PDBe
6NL8 contains 1 α-helix and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-8 | 7 | 1 |
| β-strand | 13-19 | 7 | 1 |
| α-helix | 23-36 | 14 | |
| β-strand | 42-46 | 5 | 1 |
| β-strand | 51-55 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Immunoglobulin G-binding protein G | A | protein | 56 | Streptococcus | P19909 (AlphaFold model) |
>6NL8_1 Immunoglobulin G-binding protein G (chains A) MTYKLILNGKTHKGELTTEAVDAATAEKHFKQHANDLGVDGEWTYDDATKTFTVTE
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Water and common crystallization additives (CL) are not listed.
Design of High-Affinity Metal-Controlled Protein Dimers. Maniaci, B., Lipper, C.H., Anipindi, D.L. et al. Biochemistry (2019) 58:2199-2207. DOI 10.1021/acs.biochem.9b00055 · PubMed
Other PDB entries of the same protein (UniProt P19909 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6NL8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.