Cryo-EM structure of full-length chicken STING in the cGAMP-bound dimeric state. Determined by electron microscopy at 4.0 Å resolution. Released 6 Mar 2019.
Explore 6NT7 in 3D Show helices and sheets RCSB PDB PDBe
6NT7 contains 36 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-20 | 5 | |
| α-helix | 24-40 | 17 | |
| α-helix | 50-75 | 26 | |
| α-helix | 76-78 | 3 | |
| α-helix | 79-83 | 5 | |
| α-helix | 88-94 | 7 | |
| α-helix | 100-107 | 8 | |
| α-helix | 127-139 | 13 | |
| α-helix | 146-155 | 10 | |
| β-strand | 159 | 1 | 1 |
| α-helix | 160-168 | 9 | |
| α-helix | 169-173 | 5 | |
| α-helix | 174-176 | 3 | |
| α-helix | 177-179 | 3 | |
| α-helix | 180-188 | 9 | |
| α-helix | 198-200 | 3 | |
| β-strand | 203-208 | 6 | 2 |
| β-strand | 224-228 | 5 | 3 |
| β-strand | 233-237 | 5 | 4 |
| β-strand | 240-245 | 6 | 4 |
| β-strand | 249-252 | 4 | 3 |
| β-strand | 260-263 | 4 | 3 |
| β-strand | 264-266 | 3 | 2 |
| α-helix | 270-275 | 6 | |
| α-helix | 286-305 | 20 | |
| β-strand | 314-319 | 6 | 2 |
| α-helix | 330-340 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Stimulator of interferon genes protein | A, B | protein | 392 | Gallus gallus | E1C7U0 (AlphaFold model) |
>6NT7_1 Stimulator of interferon genes protein (chains A, B) MPQDPSTRSSPARLLIPEPRAGRARHAACVLLAVCFVVLFLSGEPLAPIIRSVCTQLAAL QLGVLLKGCCCLAEEIFHLHSRHHGSLWQVLCSCFPPRWYLALLLVGGSAYLDPPEDNGH SPRLALTLSCLCQLLVLALGLQKLSAVEVSELTESSKKNVAHGLAWSYYIGYLKVVLPRL KECMEELSRTNPMLRAHRDTWKLHILVPLGCDIWDDLEKADSNIQYLADLPETILTRAGI KRRVYKHSLYVIRDKDNKLRPCVLEFASPLQTLCAMSQDDCAAFSREQRLEQARLFYRSL RDILGSSKECAGLYRLIAYEEPAEPESHFLSGLILWHLQQQQREEYMVQEELPLGTSSVE LSLQVSSSDLPQPLRSDCPGIHRPDYKDDDDK
| ID | Name | Formula | Copies |
|---|---|---|---|
| 1SY | cGAMP | C20 H24 N10 O13 P2 | 1 |
Cryo-EM structures of STING reveal its mechanism of activation by cyclic GMP-AMP. Shang, G., Zhang, C., Chen, Z.J. et al. Nature (2019) 567:389-393. DOI 10.1038/s41586-019-0998-5 · PubMed
Other PDB entries of the same protein (UniProt E1C7U0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6NT7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.