6NT8: Stimulator of interferon genes protein

Cryo-EM structure of full-length chicken STING in the cGAMP-bound tetrameric state. Determined by electron microscopy at 6.5 Å resolution. Released 6 Mar 2019.

Method: Electron microscopy
Resolution: 6.5 Å
Organism: Gallus gallus
Chains: 4
Atoms: 9,458
Mol. weight: 178.18 kDa
Ligands: 1SY
Released: 6 Mar 2019

Explore 6NT8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6NT8 contains 72 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, D and E: 18 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	16-20	5
α-helix	24-40	17
α-helix	50-75	26
α-helix	76-78	3
α-helix	79-83	5
α-helix	88-94	7
α-helix	100-107	8
α-helix	127-139	13
α-helix	146-155	10
β-strand	159	1	1
α-helix	160-168	9
α-helix	169-173	5
α-helix	174-176	3
α-helix	177-179	3
α-helix	180-188	9
α-helix	198-200	3
β-strand	203-208	6	2
β-strand	224-228	5	3
β-strand	233-237	5	4
β-strand	240-245	6	4
β-strand	249-252	4	3
β-strand	260-263	4	3
β-strand	264-266	3	2
α-helix	270-275	6
α-helix	286-305	20
β-strand	314-319	6	2
α-helix	330-340	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stimulator of interferon genes protein	A, B, D, E	protein	392	Gallus gallus	E1C7U0 (AlphaFold model)

Sequence of entity 1 (A, B, D, E), FASTA

>6NT8_1 Stimulator of interferon genes protein (chains A, B, D, E)
MPQDPSTRSSPARLLIPEPRAGRARHAACVLLAVCFVVLFLSGEPLAPIIRSVCTQLAAL
QLGVLLKGCCCLAEEIFHLHSRHHGSLWQVLCSCFPPRWYLALLLVGGSAYLDPPEDNGH
SPRLALTLSCLCQLLVLALGLQKLSAVEVSELTESSKKNVAHGLAWSYYIGYLKVVLPRL
KECMEELSRTNPMLRAHRDTWKLHILVPLGCDIWDDLEKADSNIQYLADLPETILTRAGI
KRRVYKHSLYVIRDKDNKLRPCVLEFASPLQTLCAMSQDDCAAFSREQRLEQARLFYRSL
RDILGSSKECAGLYRLIAYEEPAEPESHFLSGLILWHLQQQQREEYMVQEELPLGTSSVE
LSLQVSSSDLPQPLRSDCPGIHRPDYKDDDDK

Ligands and cofactors

ID	Name	Formula	Copies
1SY	cGAMP	C20 H24 N10 O13 P2	2

Primary citation

Cryo-EM structures of STING reveal its mechanism of activation by cyclic GMP-AMP. Shang, G., Zhang, C., Chen, Z.J. et al. Nature (2019) 567:389-393. DOI 10.1038/s41586-019-0998-5 · PubMed

Other PDB entries of the same protein (UniProt E1C7U0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6NT9 3.3 Å, Cryo-EM structure of the complex between human TBK1 and chicken STING
8IK0 3.3 Å, Cryo-EM structure of Stimulator of interferon genes
6NT6 4.0 Å, Cryo-EM structure of full-length chicken STING in the apo state
6NT7 4.0 Å, Cryo-EM structure of full-length chicken STING in the cGAMP-bound dimeric state

Browse structure collections

About this viewer

MolViewer shows 6NT8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.