Drosophila melanogaster CENP-C cupin domain. Determined by X-ray diffraction at 1.81 Å resolution. Released 21 Aug 2019.
Explore 6O2K in 3D Show helices and sheets RCSB PDB PDBe
6O2K contains 7 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1275-1287 | 13 | |
| β-strand | 1306-1307 | 2 | 1 |
| α-helix | 1309-1311 | 3 | |
| β-strand | 1315-1317 | 3 | 2 |
| β-strand | 1320-1324 | 5 | 2 |
| β-strand | 1333-1338 | 6 | 2 |
| β-strand | 1343-1348 | 6 | 3 |
| β-strand | 1354-1360 | 7 | 2 |
| β-strand | 1363-1368 | 6 | 3 |
| β-strand | 1376-1380 | 5 | 3 |
| β-strand | 1385-1388 | 4 | 2 |
| β-strand | 1393-1398 | 6 | 3 |
| β-strand | 1404-1410 | 7 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1271-1273 | 3 | |
| α-helix | 1275-1288 | 14 | |
| α-helix | 1294-1296 | 3 | |
| α-helix | 1299-1302 | 4 | |
| β-strand | 1306-1307 | 2 | 2 |
| α-helix | 1309-1311 | 3 | |
| β-strand | 1315-1317 | 3 | 1 |
| β-strand | 1320-1324 | 5 | 1 |
| β-strand | 1333-1338 | 6 | 1 |
| β-strand | 1343-1348 | 6 | 4 |
| β-strand | 1354-1360 | 7 | 1 |
| β-strand | 1362-1368 | 7 | 4 |
| β-strand | 1376-1381 | 6 | 4 |
| β-strand | 1385-1388 | 4 | 1 |
| β-strand | 1393-1398 | 6 | 4 |
| β-strand | 1404-1410 | 7 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Centromeric protein-C, isoform A | A, B | protein | 142 | Drosophila melanogaster | Q9VHP9 (AlphaFold model) |
>6O2K_1 Centromeric protein-C, isoform A (chains A, B) TPLRDEQEEASTKLMQWLRGVGDAPPSASMSDENASVSSANELIFCQVDGIDYAFYNTKE KAMLGYMRFKPYQKRSMKQAKVHPLKLLVQFGEFNVETLAVGEEKEVHSVLRVGDMIEID RGTRYSIQNAIDKVSVLMCIRS
Structures of CENP-C cupin domains at regional centromeres reveal unique patterns of dimerization and recruitment functions for the inner pocket. Chik, J.K., Moiseeva, V., Goel, P.K. et al. J Biol Chem (2019) 294:14119-14134. DOI 10.1074/jbc.RA119.008464 · PubMed
Other PDB entries of the same protein (UniProt Q9VHP9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6O2K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.