6OIE: The double PHD finger (DPF) of MORF

The double PHD finger (DPF) of MORF in complex with histone H3K14cr. Determined by X-ray diffraction at 2.08 Å resolution. Released 20 Nov 2019.

Method: X-ray diffraction
Resolution: 2.08 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,192
Mol. weight: 30.84 kDa
Ligands: ZN
Released: 20 Nov 2019

Explore 6OIE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6OIE contains 18 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	211-213	3
β-strand	216	1	1
α-helix	233-234	2
β-strand	235-236	2	1
β-strand	243-244	2	1
α-helix	246-249	4
α-helix	253-260	8
β-strand	272	1	2
α-helix	282-284	3
β-strand	286-287	2	2
β-strand	294-295	2	2
α-helix	297-299	3
α-helix	303-304	2
α-helix	307-309	3

Chain B: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	211-213	3
β-strand	216	1	3
β-strand	235-236	2	3
β-strand	243-244	2	3
α-helix	246-249	4
α-helix	253-259	7
β-strand	272	1	4
β-strand	285-287	3	4
β-strand	294-296	3	4
α-helix	297-299	3
α-helix	303-304	2
α-helix	307-308	2

Chains C and D: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-3	2	4
α-helix	4-11	8
α-helix	13-15	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone acetyltransferase KAT6B	A, B	protein	116	Homo sapiens	Q8WYB5 (AlphaFold model)
Histone H3.1t peptide	C, D	protein	19	Homo sapiens	Q16695 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6OIE_1 Histone acetyltransferase KAT6B (chains A, B)
GSHMDPIPICSFCLGTKESNREKKPEELLSCADCGSSGHPSCLKFCPELTTNVKALRWQC
IECKTCSACRVQGRNADNMLFCDSCDRGFHMECCDPPLSRMPKGMWICQVCRPKKK

Sequence of entity 2 (C, D), FASTA

>6OIE_2 Histone H3.1t peptide (chains C, D)
ARTKQTARKSTGGXAPRKQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	8

Primary citation

Histone H3K23-specific acetylation by MORF is coupled to H3K14 acylation. Klein, B.J., Jang, S.M., Lachance, C. et al. Nat Commun (2019) 10:4724-4724. DOI 10.1038/s41467-019-12551-5 · PubMed

Other PDB entries of the same protein (UniProt Q8WYB5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5U2J 1.6 Å, MORF double PHD finger (DPF) in complex with histone H3K14bu
8E4V Solution structure of the WH domain of MORF

Browse structure collections

About this viewer

MolViewer shows 6OIE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.