8E4V: WH domain of MORF

Solution structure of the WH domain of MORF. Determined by solution NMR. Released 10 May 2023.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 670
Mol. weight: 9.52 kDa
Released: 10 May 2023

Explore 8E4V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8E4V contains 4 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	107-118	12
β-strand	124	1	1
α-helix	126-135	10
α-helix	140-144	5
α-helix	147-162	16
β-strand	165-168	4	1
β-strand	171-174	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 3 of Histone acetyltransferase KAT6B	A	protein	84	Homo sapiens	Q8WYB5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8E4V_1 Isoform 3 of Histone acetyltransferase KAT6B (chains A)
GNDLRNVDWNKLLRRAIEGLEEPNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKR
AVNNGRLLKDGPQYRVNYGSLDGK

Primary citation

MORF and MOZ acetyltransferases target unmethylated CpG islands through the winged helix domain. Becht, D.C., Klein, B.J., Kanai, A. et al. Nat Commun (2023) 14:697-697. DOI 10.1038/s41467-023-36368-5 · PubMed

Other PDB entries of the same protein (UniProt Q8WYB5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5U2J 1.6 Å, MORF double PHD finger (DPF) in complex with histone H3K14bu
6OIE 2.08 Å, The double PHD finger (DPF) of MORF in complex with histone H3K14cr

Browse structure collections

About this viewer

MolViewer shows 8E4V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.