6OUA: Yeast Ctf3 complex

Cryo-EM structure of the yeast Ctf3 complex. Determined by electron microscopy at 4.18 Å resolution. Released 15 May 2019.

Method: Electron microscopy
Resolution: 4.18 Å
Organism: Saccharomyces cerevisiae
Chains: 3
Atoms: 5,208
Mol. weight: 133.93 kDa
Released: 15 May 2019

Explore 6OUA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6OUA contains 33 α-helices and 2 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	10-38	29
α-helix	50-65	16
α-helix	84-89	6
α-helix	103-128	26
α-helix	129-131	3

Chain I: 22 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	343-347	5
α-helix	355-367	13
α-helix	373-374	2
α-helix	375-377	3
α-helix	379-385	7
α-helix	390-396	7
α-helix	413-419	7
α-helix	433-447	15
α-helix	459-474	16
α-helix	479-493	15
α-helix	509-524	16
α-helix	532-534	3
α-helix	551-564	14
α-helix	579-592	14
α-helix	609-612	4
α-helix	615-617	3
α-helix	626-629	4
β-strand	630	1	1
β-strand	632	1	1
α-helix	642-652	11
α-helix	659-660	2
α-helix	669-674	6
α-helix	693-696	4
α-helix	698-704	7

Chain K: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	7-31	25
α-helix	35-37	3
α-helix	50-56	7
α-helix	72-74	3
α-helix	81-106	26
α-helix	110-127	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Inner kinetochore subunit CTF3	I	protein	736	Saccharomyces cerevisiae	Q12748 (AlphaFold model)
Inner kinetochore subunit MCM16	H	protein	184	Saccharomyces cerevisiae	Q12262 (AlphaFold model)
Inner kinetochore subunit MCM22	K	protein	242	Saccharomyces cerevisiae	P47167 (AlphaFold model)

Sequence of entity 1 (I), FASTA

>6OUA_1 Inner kinetochore subunit CTF3 (chains I)
SNAMSLILDDIILSLTNANERTPPQALKTTLSLLYEKSKQYGLSSPQLQALVRLLCETSI
IDTVTKVYIVENCFLPDGYLTKELLLEIINHLGTPTVFSRYRIQTPPVLQSALCKWLVHV
YFLFPVHSEREHNISSSIWLHLWQFSFLQKWITPLVIWQATTPVDVKPWKLSIIKRCAMH
PGYRDAPGSATLILQRFQCLVGASSQITESIITINCNRKTLKSHRNLKLDAHFLSILKRI
LSRAHPANFPADTVQNTIDMYLSEIHQLGADSIYPLRLQSLPEYVPSDSTVSLWDVTSLE
QLAQNWPQLHIPNDVDYMMKPSLNSNVLLPRKVMSRDSLKHLYSSIILIKNSRDESSSPY
EWCIWQLKRCFAHQIETPQEVIPIIISVSSMDNKLSSRIIQTFCNLKYLKLDELTLKKVC
GGILPLWKPELISGTREFFVKFMASIFMWSTRDGHDNNCTFSETCFYVLQMITNWVLDDK
LIALGLTLLHDMQSLLTLDKIFNNATSNRFSTMAFISSLDILTQLSKQTKSDYAIQYLIV
GPDIMNKVFSSDDPLLLSAACRYLVATKNKLMQYPSTNKFVRMQNQYIMDLTNYLYRNKV
LSSKSLFGVSPDFFKQILENLYIPTADFKNAKFFTITGIPALSYICIIILRRLETAENTK
IKFTSGIINEETFNNFFRVHHDEIGQHGWIKGVNNIHDLRVKILMHLSNTANPYRDIAAF
LFTYLKSLSKYSVQNS

Sequence of entity 2 (H), FASTA

>6OUA_2 Inner kinetochore subunit MCM16 (chains H)
SNAMTNSSEKQWERIQQLEKEHVEVYRELLITLDRLYLIRKHNHAVILSHTQQRLLEIRH
QLQINLEKTALLIRLLEKPDNTNVLFTKLQNLLEESNSLDYELLQSLGAQSSLHKQLIES
RAERDELMSKLIELSSKFPKPTIPPDDSDTAGKQVEVEKENETIQELMIALQIHSGYTNI
SYTI

Sequence of entity 3 (K), FASTA

>6OUA_3 Inner kinetochore subunit MCM22 (chains K)
SNAMDVEKDVLDVYIKNLENQIGNKRYFLKQAQGAIDEITKRSLDTEGKPVNSEVFTELL
RKPMFFSERADPIGFSLTSNFLSLRAQSSSEWLSLMNDQSVDQKAMLLLQNNINSDLKEL
LRKLQHQMTIMDSKKQDHAHIRTRKARNKELWDSLADFLKGYLVPNLDDNDESIDSLTNE
VMLLMKRLIEHDLNLTLNDFSSKTIPIYRLLLRANIITVIEGSTNPGTKYIKLIDFNETS
LT

Primary citation

The structure of the yeast Ctf3 complex. Hinshaw, S.M., Dates, A.N., Harrison, S.C. Elife (2019) 8. DOI 10.7554/eLife.48215 · PubMed

Other PDB entries of the same protein (UniProt Q12748 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YPC 2.9 Å, Crystal structure of the kinetochore subunits H/I/K/T/W penta-complex from S. cerevisiae…
6WUC 3.23 Å, The yeast Ctf3 complex with Cnn1-Wip1
10FI 3.3 Å, apo CCAN purified from budding yeast
8OVW 3.4 Å, Cryo-EM structure of CBF1-CCAN bound topologically to centromeric DNA
8OW0 3.4 Å, Cryo-EM structure of CBF1-CCAN bound topologically to a centromeric CENP-A nucleosome
6QLE 3.55 Å, Structure of inner kinetochore CCAN complex
7L7Q 3.7 Å, Ctf3c with Ulp2-KIM
8OW1 3.7 Å, Cryo-EM structure of the yeast Inner kinetochore bound to a CENP-A nucleosome.
10DQ 3.9 Å, Cbf1-CCAN-CEN complex
6QLD 4.15 Å, Structure of inner kinetochore CCAN-Cenp-A complex
6NUW 4.25 Å, Yeast Ctf19 complex
10JC 6.5 Å, CCAN dimer purified from budding yeast

Browse structure collections

About this viewer

MolViewer shows 6OUA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.