Crystal Structure of Hendra Virus Attachment G Glycoprotein. Determined by X-ray diffraction at 2.2 Å resolution. Released 27 Nov 2019.
Explore 6PD4 in 3D Show helices and sheets RCSB PDB PDBe
6PD4 contains 15 α-helices and 67 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 178-180 | 3 | 1 |
| α-helix | 185-187 | 3 | |
| β-strand | 201-202 | 2 | 1 |
| α-helix | 203-204 | 2 | |
| β-strand | 205 | 1 | 2 |
| β-strand | 215-225 | 11 | 2 |
| β-strand | 228-237 | 10 | 2 |
| β-strand | 244-257 | 14 | 2 |
| β-strand | 263-271 | 9 | 2 |
| β-strand | 279-287 | 9 | 3 |
| β-strand | 290-297 | 8 | 3 |
| α-helix | 310-312 | 3 | |
| β-strand | 314-320 | 7 | 3 |
| β-strand | 332-337 | 6 | 3 |
| β-strand | 339-341 | 3 | 4 |
| β-strand | 347-350 | 4 | 4 |
| β-strand | 354 | 1 | 3 |
| β-strand | 356-358 | 3 | 4 |
| β-strand | 361-371 | 11 | 4 |
| α-helix | 372-374 | 3 | |
| α-helix | 379-381 | 3 | |
| α-helix | 394-397 | 4 | |
| β-strand | 407-417 | 11 | 4 |
| β-strand | 425-430 | 6 | 4 |
| β-strand | 431 | 1 | 5 |
| α-helix | 432 | 1 | |
| β-strand | 442-447 | 6 | 6 |
| β-strand | 450-455 | 6 | 6 |
| β-strand | 465-471 | 7 | 6 |
| β-strand | 475 | 1 | 5 |
| β-strand | 476-479 | 4 | 6 |
| β-strand | 509 | 1 | 1 |
| β-strand | 511-515 | 5 | 7 |
| β-strand | 520-526 | 7 | 7 |
| β-strand | 533 | 1 | 8 |
| β-strand | 535-541 | 7 | 7 |
| β-strand | 544-550 | 7 | 7 |
| β-strand | 557 | 1 | 8 |
| β-strand | 558-568 | 11 | 1 |
| β-strand | 571-582 | 12 | 1 |
| β-strand | 587-596 | 10 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 178-180 | 3 | 9 |
| α-helix | 185-187 | 3 | |
| β-strand | 201-202 | 2 | 9 |
| α-helix | 204-206 | 3 | |
| β-strand | 215-225 | 11 | 10 |
| β-strand | 228-237 | 10 | 10 |
| α-helix | 243 | 1 | |
| β-strand | 244-257 | 14 | 10 |
| β-strand | 263-271 | 9 | 10 |
| β-strand | 279-287 | 9 | 11 |
| β-strand | 290-297 | 8 | 11 |
| α-helix | 310-312 | 3 | |
| β-strand | 314-320 | 7 | 11 |
| β-strand | 332-337 | 6 | 11 |
| β-strand | 339-341 | 3 | 12 |
| β-strand | 347-350 | 4 | 12 |
| β-strand | 354 | 1 | 11 |
| β-strand | 356-358 | 3 | 12 |
| β-strand | 361-371 | 11 | 12 |
| α-helix | 372-374 | 3 | |
| α-helix | 379-381 | 3 | |
| α-helix | 394-397 | 4 | |
| β-strand | 407-417 | 11 | 12 |
| β-strand | 425-430 | 6 | 12 |
| β-strand | 431 | 1 | 13 |
| α-helix | 432 | 1 | |
| β-strand | 442-447 | 6 | 14 |
| β-strand | 450-455 | 6 | 14 |
| β-strand | 465-471 | 7 | 14 |
| β-strand | 475 | 1 | 13 |
| β-strand | 476-479 | 4 | 14 |
| β-strand | 509 | 1 | 9 |
| β-strand | 511-515 | 5 | 15 |
| β-strand | 520-526 | 7 | 15 |
| β-strand | 533 | 1 | 16 |
| β-strand | 535-541 | 7 | 15 |
| β-strand | 544-550 | 7 | 15 |
| β-strand | 557 | 1 | 16 |
| β-strand | 558-568 | 11 | 9 |
| β-strand | 571-582 | 12 | 9 |
| β-strand | 587-596 | 10 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Attachment glycoprotein | A, B | protein | 441 | Hendra henipavirus | O89343 (AlphaFold model) |
>6PD4_1 Attachment glycoprotein (chains A, B) YRPISQGVSDLVGLPNQICLQKTTSTILKPRLISYTLPINTREGVCITDPLLAVDNGFFA YSHLEKIGSCTRGIAKQRIIGVGEVLDRGDKVPSMFMTNVWTPPNPSTIHHCSSTYHEDF YYTLCAVSHVGDPILNSTSWTESLSLIRLAVRPKSDSGDYNQKYIAITKVERGKYDKVMP YGPSGIKQGDTLYFPAVGFLPRTEFQYNDSNCPIIHCKYSKAENCRLSMGVNSKSHYILR SGLLKYNLSLGGDIILQFIEIADNRLTIGSPSKIYNSLGQPVFYQASYSWDTMIKLGDVD TVDPLRVQWRNNSVISRPGQSQCPRFNVCPEVCWEGTYNDAFLIDRLNWVSAGVYLNSNQ TAENPVFAVFKDNEILYQVPLAEDDTNAQKTITDCFLLENVIWCISLVEIYDTGDSVIRP KLFAVKIPAQCSESGRGLVPR
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Water and common crystallization additives (SO4) are not listed.
New insights into the Hendra virus attachment and entry process from structures of the virus G glycoprotein and its complex with Ephrin-B2. Xu, K., Chan, Y.P., Rajashankar, K.R. et al. PLoS One (2012) 7:e48742. DOI 10.1371/journal.pone.0048742 · PubMed
Other PDB entries of the same protein (UniProt O89343 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6PD4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.