6PQQ: Human TRPA1 C621S mutant in the apo state

Cryo-EM structure of human TRPA1 C621S mutant in the apo state. Determined by electron microscopy at 2.81 Å resolution. Released 8 Jan 2020.

Method: Electron microscopy
Resolution: 2.81 Å
Organism: Homo sapiens
Chains: 4
Atoms: 20,016
Mol. weight: 546.36 kDa
Ligands: 6OU, LBN
Released: 8 Jan 2020

Explore 6PQQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6PQQ contains 156 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 39 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	447-455	9
α-helix	459-465	7
α-helix	485-491	7
α-helix	495-503	9
α-helix	517-524	8
α-helix	527-534	8
α-helix	538-540	3
α-helix	551-557	7
α-helix	561-569	9
α-helix	583-588	6
α-helix	593-600	8
α-helix	605-610	6
α-helix	622-628	7
α-helix	631-639	9
β-strand	642-644	3	1
β-strand	656-659	4	1
α-helix	684-691	8
α-helix	695-698	4
α-helix	701-710	10
α-helix	711-715	5
α-helix	716-739	24
α-helix	741	1
β-strand	745-746	2	2
β-strand	751-752	2	2
β-strand	762-763	2	2
α-helix	767-795	29
α-helix	803-819	17
α-helix	820-822	3
α-helix	828-849	22
α-helix	850-852	3
α-helix	857-891	35
α-helix	896-898	3
α-helix	901-911	11
α-helix	918	1
α-helix	919-923	5
α-helix	924-927	4
α-helix	934-946	13
α-helix	947-952	6
α-helix	953-968	16
α-helix	971-986	16
α-helix	992-998	7
β-strand	1002-1005	4	1
α-helix	1010-1011	2
α-helix	1016-1024	9
α-helix	1041-1071	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transient receptor potential cation channel subfamily A member 1	A, B, C, D	protein	1152	Homo sapiens	O75762 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6PQQ_1 Transient receptor potential cation channel subfamily A member 1 (chains A, B, C, D)
MAKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKESLKVVFEGSAYGLQNFNKQKKLKRC
DDMDTFFLHYAAAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLS
RGANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSE
ALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGK
ATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSV
DIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVN
LLLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHY
ACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGD
LHGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLK
CTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTI
IRSKRWDECLKIFSHNSPGNKSPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYN
FKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAH
MMNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEILDTTNSYLIKTCMILVFL
SSIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAV
YFYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFS
SPLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGL
AVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHI
FCFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETE
DDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEPSNSLEVLFQGPAADYKDDDD
KAHHHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
6OU	[(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-y…	C39 H76 N O8 P	20
LBN	1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine	C42 H82 N O8 P	8

Primary citation

Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel. Suo, Y., Wang, Z., Zubcevic, L. et al. Neuron (2020) 105:882. DOI 10.1016/j.neuron.2019.11.023 · PubMed

Other PDB entries of the same protein (UniProt O75762 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HC8 1.9 Å, Factor Inhibiting HIF (FIH) in complex with zinc, NOG and TRPA1 (313-339)
9VU1 2.59 Å, Structure of hTRPA1 complexed with LIQA
6V9V 2.6 Å, Structure of TRPA1 modified by Bodipy-iodoacetamide with bound calcium, LMNG
7OR0 2.64 Å, Cryo-EM structure of the human TRPA1 ion channel in complex with the antagonist 3-60,…
7OR1 2.64 Å, Cryo-EM structure of the human TRPA1 ion channel in complex with the antagonist 3-60,…
9MOE 2.7 Å, Preclinical and clinical evaluation of a novel TRPA1 antagonist LY3526318
6PQO 2.88 Å, Cryo-EM structure of the human TRPA1 ion channel in complex with the covalent agonist…
6X2J 3.0 Å, Structure of human TRPA1 in complex with agonist GNE551
7JUP 3.05 Å, Structure of human TRPA1 in complex with antagonist compound 21
6PQP 3.06 Å, Cryo-EM structure of the human TRPA1 ion channel in complex with the covalent agonist BITC
6V9W 3.1 Å, Structure of TRPA1 (ligand-free) with bound calcium, LMNG
9M8S 3.1 Å, Cryo-EM structure of the human TRPA1 ion channel in ligand-free state.

Browse structure collections

About this viewer

MolViewer shows 6PQQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.