6PSA: PIE12 D-peptide against HIV entry

PIE12 D-peptide against HIV entry (in complex with IQN17 Q577R resistance mutant). Determined by X-ray diffraction at 1.3 Å resolution. Released 5 Feb 2020.

Method: X-ray diffraction
Resolution: 1.3 Å
Organisms: synthetic construct, Saccharomyces cerevisiae, Human immunodeficiency virus type 1
Chains: 2
Atoms: 606
Mol. weight: 7.64 kDa
Released: 5 Feb 2020

Explore 6PSA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6PSA contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-44	43

Chain H: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	4-6	3
α-helix	8-10	3
α-helix	11-14	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PIE12 D-peptide	H	protein	18	synthetic construct
IQN17	A	protein	47	Saccharomyces cerevisiae, Human immunodeficiency virus type 1	P03069 (AlphaFold model), P04578 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>6PSA_1 PIE12 D-peptide (chains H)
XKGHPCDYPEWQWLCELX

Sequence of entity 2 (A), FASTA

>6PSA_2 IQN17 (chains A)
XRMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLRARILX

Primary citation

Characterization of resistance to a potent D-peptide HIV entry inhibitor. Smith, A.R., Weinstock, M.T., Siglin, A.E. et al. Retrovirology (2019) 16:28-28. DOI 10.1186/s12977-019-0489-7 · PubMed

Other PDB entries of the same protein (UniProt P03069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AZD 0.98 Å, Crystal structure of tropomyosin N-terminal fragment at 0.98A resolution
2WQ1 1.08 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating bromide
2WQ0 1.12 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride
4OWI 1.2 Å, peptide structure
2WQ3 1.22 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride and nitrate
2HY6 1.25 Å, A seven-helix coiled coil
2WPZ 1.25 Å, GCN4 leucine zipper mutant with two VxxNxxx motifs coordinating chloride
2IPZ 1.35 Å, A Parallel Coiled-Coil Tetramer with Offset Helices
2YNY 1.35 Å, Salmonella enterica SadA 255-302 fused to GCN4 adaptors (SadAK1)
5APU 1.35 Å, Sequence IANKEDKAD inserted between GCN4 adaptors - Structure A9b black
2WQ2 1.36 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating iodide
5APS 1.37 Å, Sequence IENKKAD inserted between GCN4 adaptors - Structure A7

Browse structure collections

About this viewer

MolViewer shows 6PSA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.