6PSQ: DNA-directed RNA polymerase subunit beta'

Escherichia coli RNA polymerase closed complex (TRPc) with TraR and rpsT P2 promoter. Determined by electron microscopy at 3.4 Å resolution. Released 25 Mar 2020.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Escherichia coli
Chains: 10
Atoms: 32,777
Mol. weight: 562.9 kDa
Ligands: MG, 1N7, ZN
Released: 25 Mar 2020

Explore 6PSQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6PSQ contains 173 α-helices and 228 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain G: 5 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	34
β-strand	23	1	35
β-strand	24-31	8	34
α-helix	35-49	15
β-strand	52-53	2	36
β-strand	56-59	4	37
β-strand	74	1	38
α-helix	78-85	8
β-strand	90-92	3	39
β-strand	97-105	9	37
β-strand	108-111	4	38
α-helix	112-114	3
β-strand	115-116	2	37
β-strand	121-123	3	39
β-strand	129-133	5	38
β-strand	139-147	9	37
β-strand	149-150	2	36
β-strand	153	1	40
α-helix	156-158	3
β-strand	171-172	2	37
β-strand	175	1	40
β-strand	180-182	3	35
β-strand	185-189	5	34
β-strand	199-203	5	34
β-strand	206-207	2	35
α-helix	213-233	21

Chain H: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
β-strand	16	1	41
β-strand	23-31	9	41
α-helix	32	1
α-helix	35-49	15
β-strand	53-61	9	42
β-strand	74	1	43
α-helix	79-86	8
β-strand	90-91	2	44
β-strand	99-101	3	42
β-strand	104-105	2	45
β-strand	109-110	2	46
β-strand	122-123	2	44
β-strand	131-132	2	46
β-strand	133	1	43
β-strand	139-140	2	45
β-strand	142-149	8	42
β-strand	152-153	2	47
α-helix	155-157	3
β-strand	172	1	42
β-strand	175-176	2	47
β-strand	180-182	3	41
β-strand	187	1	41
β-strand	190	1	48
β-strand	198	1	48
β-strand	199-207	9	41
α-helix	213-227	15

Chain I: 55 helices, 96 β-strands

Element	Residues	Length	Sheet
β-strand	13-14	2	49
α-helix	19-20	2
α-helix	29-38	10
α-helix	50-53	4
β-strand	59-60	2	50
β-strand	66-75	10	50
α-helix	82-88	7
β-strand	93-105	13	50
β-strand	114-117	4	50
β-strand	122-128	7	50
β-strand	136-137	2	51
β-strand	142-145	4	51
β-strand	147-148	2	52
β-strand	151	1	53
α-helix	152	1
β-strand	154-157	4	54
β-strand	174-177	4	54
β-strand	180	1	55
β-strand	184-187	4	54
β-strand	195-198	4	54
α-helix	207-212	6
α-helix	217-224	8
β-strand	227-231	5	56
β-strand	238-240	3	56
α-helix	243-246	4
β-strand	250	1	57
β-strand	255-257	3	58
β-strand	260-263	4	58
α-helix	267	1
β-strand	268	1	57
α-helix	269-270	2
α-helix	271-280	10
β-strand	284-285	2	56
β-strand	296-297	2	56
β-strand	302	1	59
β-strand	309	1	59
β-strand	315-316	2	56
α-helix	319-328	10
β-strand	333-336	4	56
α-helix	347-353	7
α-helix	359-370	12
α-helix	378-388	11
β-strand	396	1	55
α-helix	399-408	10
α-helix	422-437	16
α-helix	442-444	3
β-strand	451	1	53
β-strand	454	1	52
α-helix	456-480	25
α-helix	496-507	12
β-strand	512-514	3	51
α-helix	515-516	2
α-helix	520-527	8
β-strand	529	1	60
β-strand	530-531	2	52
β-strand	558	1	61
β-strand	574	1	60
β-strand	575	1	61
β-strand	580-581	2	62
β-strand	587-588	2	62
β-strand	589-594	6	63
β-strand	599-606	8	63
α-helix	608-611	4
β-strand	616	1	63
β-strand	634-639	6	63
β-strand	641-645	5	63
α-helix	647-649	3
β-strand	652-654	3	63
α-helix	657-659	3
α-helix	664-666	3
α-helix	671-673	3
β-strand	674	1	64
α-helix	676-686	11
β-strand	689	1	65
α-helix	690-691	2
β-strand	701	1	49
α-helix	704-711	8
β-strand	717	1	66
β-strand	722-726	5	67
β-strand	731-736	6	67
β-strand	749-752	4	67
α-helix	753-754	2
β-strand	757-758	2	68
β-strand	763	1	69
β-strand	764-765	2	68
β-strand	768-769	2	70
β-strand	776-777	2	67
β-strand	782	1	66
β-strand	784-785	2	70
β-strand	789	1	71
β-strand	794	1	71
β-strand	798-804	7	72
β-strand	816-819	4	72
α-helix	820-824	5
β-strand	830-841	12	69
β-strand	843	1	73
β-strand	846	1	73
β-strand	849	1	74
α-helix	859-862	4
β-strand	865	1	75
β-strand	870	1	76
β-strand	871	1	75
β-strand	876-878	3	69
β-strand	882-884	3	76
β-strand	887-889	3	74
α-helix	899-905	7
β-strand	913-915	3	74
β-strand	918-919	2	76
α-helix	920-921	2
β-strand	925-935	11	69
α-helix	943-978	36
α-helix	994-997	4
α-helix	1006-1036	31
α-helix	1039-1041	3
β-strand	1046-1058	13	69
β-strand	1065-1067	3	77
β-strand	1073-1075	3	77
β-strand	1076-1080	5	72
β-strand	1087-1088	2	78
α-helix	1092	1
β-strand	1093	1	78
α-helix	1094	1
β-strand	1096-1098	3	72
α-helix	1100-1102	3
β-strand	1108	1	64
α-helix	1110-1133	24
α-helix	1138-1150	13
α-helix	1170-1175	6
β-strand	1182-1183	2	49
α-helix	1192-1201	10
β-strand	1209-1210	2	72
β-strand	1212-1213	2	78
α-helix	1219	1
β-strand	1220	1	78
α-helix	1221	1
α-helix	1224	1
β-strand	1225-1232	8	72
β-strand	1233	1	77
β-strand	1235	1	65
α-helix	1239-1241	3
β-strand	1244	1	11
β-strand	1251	1	79
β-strand	1252	1	80
β-strand	1258	1	79
α-helix	1266-1267	2
β-strand	1268-1270	3	10
α-helix	1273-1280	8
α-helix	1284-1291	8
α-helix	1300-1309	10
α-helix	1321-1330	10
β-strand	1335-1339	5	1

Chain J: 59 helices, 80 β-strands

Element	Residues	Length	Sheet
β-strand	20-24	5	1
α-helix	27-33	7
β-strand	34	1	2
α-helix	50-52	3
β-strand	66	1	3
β-strand	69	1	3
α-helix	78-80	3
β-strand	84	1	4
β-strand	91	1	4
α-helix	97-99	3
β-strand	102	1	2
β-strand	103-112	10	5
α-helix	114-117	4
α-helix	125-128	4
α-helix	132-139	8
β-strand	144-146	3	6
β-strand	159-160	2	6
α-helix	162-171	10
β-strand	178-179	2	6
α-helix	181-191	11
α-helix	194-206	13
α-helix	211-229	19
α-helix	234-237	4
β-strand	238-244	7	5
α-helix	247-249	3
β-strand	254	1	7
β-strand	260	1	7
β-strand	261-262	2	8
α-helix	264-285	22
α-helix	289-307	19
β-strand	317	1	9
β-strand	323	1	9
α-helix	327-331	5
β-strand	345-347	3	10
β-strand	350-356	7	11
β-strand	365-369	5	12
α-helix	370-376	7
α-helix	378-387	10
α-helix	394-403	10
α-helix	406-416	11
β-strand	421-424	4	11
α-helix	431-433	3
β-strand	434-437	4	11
β-strand	438-442	5	12
β-strand	446-448	3	11
α-helix	451-453	3
α-helix	454-457	4
β-strand	465-469	5	11
α-helix	474-483	10
β-strand	485	1	11
β-strand	491	1	13
β-strand	498	1	13
α-helix	505-513	9
β-strand	526-527	2	14
α-helix	530-537	8
β-strand	548-556	9	14
β-strand	564-572	9	14
α-helix	574-579	6
α-helix	580-582	3
α-helix	589-591	3
α-helix	598-612	15
α-helix	615-635	21
α-helix	650-669	20
α-helix	675-702	28
β-strand	706-707	2	15
β-strand	714-715	2	15
α-helix	721-727	7
α-helix	734-740	7
β-strand	748	1	16
α-helix	753	1
β-strand	754	1	16
α-helix	755	1
α-helix	766-767	2
α-helix	769-791	23
α-helix	795-804	10
β-strand	809-811	3	17
β-strand	820-822	3	18
β-strand	825-826	2	19
β-strand	831-833	3	19
α-helix	835-839	5
β-strand	843	1	20
β-strand	844	1	18
β-strand	848-849	2	21
β-strand	856-858	3	21
β-strand	863	1	20
α-helix	866-873	8
β-strand	880-882	3	18
β-strand	894-895	2	17
α-helix	915-924	10
α-helix	926-928	3
β-strand	950	1	22
β-strand	956-957	2	23
β-strand	960-961	2	23
β-strand	965-966	2	24
β-strand	973	1	22
β-strand	974-975	2	24
β-strand	981-985	5	23
β-strand	991-996	6	23
β-strand	1002-1003	2	22
β-strand	1010-1011	2	23
β-strand	1018-1019	2	22
β-strand	1025	1	25
β-strand	1034-1038	5	26
β-strand	1042	1	27
β-strand	1046	1	27
β-strand	1047-1051	5	28
β-strand	1056-1060	5	28
β-strand	1061	1	29
α-helix	1062	1
β-strand	1077-1081	5	26
β-strand	1089	1	30
α-helix	1090	1
β-strand	1096	1	30
β-strand	1098-1100	3	26
β-strand	1105	1	29
β-strand	1106-1107	2	31
α-helix	1109-1110	2
β-strand	1122-1123	2	31
β-strand	1124	1	25
α-helix	1138-1146	9
β-strand	1161-1165	5	32
β-strand	1172-1178	7	32
β-strand	1187-1191	5	32
α-helix	1195-1196	2
β-strand	1203-1204	2	32
α-helix	1217-1224	8
α-helix	1226-1242	17
α-helix	1251-1260	10
β-strand	1263-1268	6	33
β-strand	1279-1281	3	33
α-helix	1282-1294	13
β-strand	1301-1304	4	33
α-helix	1309-1312	4
α-helix	1328-1337	10
α-helix	1341	1
β-strand	1342	1	1
α-helix	1343	1
α-helix	1349-1352	4
α-helix	1362-1372	11

Chain K: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	7-13	7
α-helix	17-31	15
α-helix	46-56	11
α-helix	61-73	13

Chain L: 36 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	8-19	12
β-strand	22	1	81
α-helix	26-29	4
α-helix	38-50	13
β-strand	55	1	81
α-helix	75-87	13
α-helix	97-107	11
α-helix	116-124	9
α-helix	129-135	7
α-helix	138-151	14
α-helix	158-161	4
β-strand	162	1	82
α-helix	214-232	19
α-helix	245-256	12
β-strand	261	1	82
α-helix	263-288	26
α-helix	289-293	5
α-helix	299-301	3
α-helix	302-306	5
α-helix	307-309	3
α-helix	320-322	3
α-helix	327-329	3
α-helix	334-351	18
α-helix	355-391	37
α-helix	392-394	3
α-helix	401-416	16
α-helix	427-445	19
α-helix	454-473	20
α-helix	480-486	7
α-helix	493-501	9
α-helix	502-504	3
β-strand	505-506	2	8
α-helix	509	1
β-strand	510	1	83
α-helix	511	1
β-strand	518	1	83
α-helix	519-521	3
β-strand	524	1	80
α-helix	529-530	2
α-helix	531-549	19
α-helix	553-562	10
α-helix	573-580	8
α-helix	584-599	16
α-helix	605-610	6

Chain M: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	256	1	84
α-helix	257-260	4
α-helix	264-273	10
β-strand	277	1	84
α-helix	286-289	4
α-helix	297-309	13

Chain N: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	4-25	22
α-helix	42-45	4
α-helix	46-51	6
α-helix	59-69	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit beta'	J	protein	1430	Escherichia coli	P0A8T7 (AlphaFold model)
Protein TraR	N	protein	72	Escherichia coli	P41065 (AlphaFold model)
DNA-directed RNA polymerase subunit alpha	G, H, M	protein	329	Escherichia coli	P0A7Z4 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	I	protein	1342	Escherichia coli	P0A8V2 (AlphaFold model)
DNA-directed RNA polymerase subunit omega	K	protein	91	Escherichia coli	P0A800
RNA polymerase sigma factor RpoD	L	protein	616	Escherichia coli	P00579
DNA (85-mer)	O	DNA	85	Escherichia coli
DNA (85-mer)	P	DNA	85	Escherichia coli

Sequence of entity 1 (J), FASTA

>6PSQ_1 DNA-directed RNA polymerase subunit beta' (chains J)
VKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAR
IFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSL
PSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKM
GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT
VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ
EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY
LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP
VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA
RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG
LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKA
ISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAE
VAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFN
SIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGAR
KGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDRVL
GRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYG
RDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKL
SNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANW
DPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKI
VDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPR
VADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFE
GERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQM
LRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFI
SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA
APQVTAEDASASLAELLNAGLGGSDNELELEVLFQGPSSGHHHHHHHHHH

Sequence of entity 2 (N), FASTA

>6PSQ_2 Protein TraR (chains N)
SDEADEAYSVTEQLTMTGINRIRQKINAHGIPVYLCEACGNPIPEARRKIFPGVTLCVEC
QAYQERQRKHYA

Sequence of entity 3 (G, H, M), FASTA

>6PSQ_3 DNA-directed RNA polymerase subunit alpha (chains G, H, M)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE

Sequence of entity 4 (I), FASTA

>6PSQ_4 DNA-directed RNA polymerase subunit beta (chains I)
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE

Sequence of entity 5 (K), FASTA

>6PSQ_5 DNA-directed RNA polymerase subunit omega (chains K)
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR

Sequence of entity 6 (L), FASTA

>6PSQ_6 RNA polymerase sigma factor RpoD (chains L)
SEFMEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVME
EAPDADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEI
DIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPT
ATHVGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKA
KGRSHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKM
PKKNFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQ
VKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVD
KFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGRE
PTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATT
ESLRAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRK
LRHPSRSEVLRSFLDD

Sequence of entity 7 (O), FASTA

>6PSQ_7 DNA (85-MER) (chains O)
GGCGGCGCTTATTTGCACAAATCCATTGACAAAAGAAGGCTAAAAGGGCATATTCCTCGG
CCTTTGAATTGTCCATATAGAACGC

Sequence of entity 8 (P), FASTA

>6PSQ_8 DNA (85-MER) (chains P)
GCGTTCTATATGGACAATTCAAAGGCCGAGGAATATGCCCTTTTAGCCTTCTTTTGTCAA
TGGATTTGTGCAAATAAGCGCCGCC

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
1N7	Chapso	C32 H59 N2 O8 S	4
ZN	Zinc ion	Zn	3

Primary citation

Stepwise Promoter Melting by Bacterial RNA Polymerase. Chen, J., Chiu, C., Gopalkrishnan, S. et al. Mol Cell (2020) 78:275. DOI 10.1016/j.molcel.2020.02.017 · PubMed

Other PDB entries of the same protein (UniProt P0A8T7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4IQZ 2.1 Å, The crystal structure of a large insert in RNA polymerase (RpoC) subunit from E. coli
8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
2AUK 2.3 Å, Structure of E. coli RNA polymerase beta' G/G' insert
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
6XL9 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA…
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…

Browse structure collections

About this viewer

MolViewer shows 6PSQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.