Hydrocarbon-Stapled Paxillin Peptide Bound to the Focal Adhesion Targeting (FAT) Domain of the Focal Adhesion Kinase (FAK). Determined by X-ray diffraction at 1.95 Å resolution. Released 22 Jul 2020.
Explore 6PW8 in 3D Show helices and sheets RCSB PDB PDBe
6PW8 contains 7 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 923-941 | 19 | |
| α-helix | 947-949 | 3 | |
| α-helix | 951-971 | 21 | |
| α-helix | 972-974 | 3 | |
| α-helix | 977-1006 | 30 | |
| α-helix | 1013-1046 | 34 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-10 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Focal adhesion kinase 1 | A | protein | 126 | Homo sapiens | Q05397 (AlphaFold model) |
| SP3 | B | protein | 15 | Homo sapiens | P49023 (AlphaFold model) |
>6PW8_1 Focal adhesion kinase 1 (chains A) DKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHR EIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQA RLKMLG
>6PW8_2 SP3 (chains B) XNLXELDRLLXELNX
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (CL) are not listed.
Stapled Peptide Ligand Bound to the Focal Adhesion Targeting (FAT) Domain of the Focal Adhesion Kinase (FAK). Thifault, D.G., Fromme, P., Martin-Garcia, J.M. To be published.
Other PDB entries of the same protein (UniProt Q05397 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6PW8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.