6PXW: Full-length insulin receptor

Cryo-EM structure of full-length insulin receptor bound to 4 insulin. 3D refinement was focused on the top part of the receptor complex. Determined by electron microscopy at 3.1 Å resolution. Released 4 Sept 2019.

Method: Electron microscopy
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 6
Atoms: 11,198
Mol. weight: 341.35 kDa
Released: 4 Sept 2019

Explore 6PXW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6PXW contains 52 α-helices and 124 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 18 helices, 60 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
β-strand	9-14	6	2
α-helix	19-22	4
β-strand	26	1	1
β-strand	28-29	2	3
β-strand	30-38	9	2
α-helix	43-45	3
β-strand	56-57	2	3
β-strand	61-66	6	2
β-strand	71	1	4
β-strand	81-82	2	3
β-strand	93-96	4	2
β-strand	103	1	4
β-strand	111-112	2	3
β-strand	117-122	6	2
α-helix	133-135	3
β-strand	144-148	5	2
α-helix	149-152	4
β-strand	171-173	3	5
β-strand	178-180	3	5
β-strand	182	1	6
β-strand	188	1	6
α-helix	189-190	2
β-strand	201	1	7
β-strand	207	1	7
β-strand	212	1	8
β-strand	216	1	9
α-helix	222-224	3
β-strand	225	1	9
β-strand	228	1	8
β-strand	231-233	3	10
β-strand	236-238	3	10
α-helix	241-242	2
β-strand	246-248	3	11
β-strand	252-254	3	11
α-helix	256-263	8
β-strand	278-280	3	11
β-strand	283-285	3	11
β-strand	292-293	2	12
β-strand	300	1	11
β-strand	302-303	2	12
α-helix	304	1
β-strand	311-312	2	13
α-helix	315-317	3
β-strand	318-321	4	14
α-helix	324-327	4
α-helix	328-330	3
β-strand	335-336	2	13
β-strand	339-342	4	14
α-helix	352-355	4
β-strand	363-364	2	13
β-strand	368-371	4	14
β-strand	378	1	15
β-strand	387-388	2	13
α-helix	393	1
β-strand	394	1	16
β-strand	398	1	16
β-strand	401-403	3	14
β-strand	410	1	15
β-strand	420-421	2	13
β-strand	425	1	16
β-strand	428-429	2	14
α-helix	436-446	11
α-helix	449-451	3
β-strand	457	1	14
β-strand	472-473	2	17
β-strand	475-480	6	18
β-strand	485-489	5	18
α-helix	497-499	3
β-strand	500-507	8	17
β-strand	509	1	19
β-strand	530-534	5	17
β-strand	551-553	3	18
β-strand	561-564	4	19
β-strand	565-570	6	17
β-strand	582-583	2	17
β-strand	586-589	4	19
α-helix	692-713	22

Chains C and D: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	8-18	11
β-strand	24	1	39
α-helix	57	1
α-helix	58-63	6
α-helix	68-72	5
β-strand	75	1	39

Chains E and F: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	8-18	11
α-helix	57	1
α-helix	58-63	6
α-helix	68-72	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin receptor	A, B	protein	1354	Homo sapiens	P06213 (AlphaFold model)
Insulin	C, D, E, F	protein	74	Homo sapiens	A6XGL2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6PXW_1 Insulin receptor (chains A, B)
HLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDY
LLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIE
KNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVE
RCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVET
CPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLL
CTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGL
IEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLT
ITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRT
SFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRS
NDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLD
PISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSP
PFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRPSR
KRRSLGDVGNVTVAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYR
IELQACNQDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNG
LIVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEP
TYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEF
LTASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTV
NESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLR
PEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRNLAARNCMVAHDFTVKIGDFG
MTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQG
LSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFP
EVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHI
PYTHMNGGKKNGAAATAPRSNPSLESSGLEVLFQ

Sequence of entity 2 (C, D, E, F), FASTA

>6PXW_2 Insulin (chains C, D, E, F)
FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQGSLQPLALEGSLQKRGIVEQCC
TSICSLYQLENYCN

Primary citation

Activation mechanism of the insulin receptor revealed by cryo-EM structure of the fully liganded receptor-ligand complex. Uchikawa, E., Choi, E., Shang, G. et al. Elife (2019) 8. DOI 10.7554/eLife.48630 · PubMed

Other PDB entries of the same protein (UniProt P06213 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BU3 1.65 Å, Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB peptide
5HHW 1.79 Å, Crystal structure of insulin receptor kinase domain in complex with…
4IBM 1.8 Å, Crystal structure of insulin receptor kinase domain in complex with an inhibitor Irfin-1
5U1M 1.8 Å, Structure of the IRS-1 PTB Domain Bound to the Juxtamembrane Region of the Insulin…
1IR3 1.9 Å, Phosphorylated insulin receptor tyrosine kinase in complex with peptide substrate and…
1P14 1.9 Å, Crystal structure of a catalytic-loop mutant of the insulin receptor tyrosine kinase
3BU6 1.95 Å, Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB phosphopeptide
1IRK 2.1 Å, Crystal structure of the tyrosine kinase domain of the human insulin receptor
3BU5 2.1 Å, Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB peptide and ATP
3EKK 2.1 Å, Insulin receptor kinase complexed with an inhibitor
8DWN 2.15 Å, Crystal structure of bis-phosphorylated insulin receptor kinase domain
3EKN 2.2 Å, Insulin receptor kinase complexed with an inhibitor

Browse structure collections

About this viewer

MolViewer shows 6PXW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.