6QB7: H1 domain of human KCTD16

Structure of the H1 domain of human KCTD16. Determined by X-ray diffraction at 2.23 Å resolution. Released 6 Feb 2019.

Method: X-ray diffraction
Resolution: 2.23 Å
Organism: Homo sapiens
Chains: 5
Atoms: 4,838
Mol. weight: 95.32 kDa
Ligands: PO4
Released: 6 Feb 2019

Explore 6QB7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6QB7 contains 20 α-helices and 30 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D and E: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	164-171	8	1
β-strand	193-197	5	1
α-helix	198-205	8
α-helix	206-208	3
β-strand	209-210	2	1
β-strand	222-228	7	1
α-helix	233-242	10
β-strand	246-258	13	1
β-strand	266-278	13	1
α-helix	279-281	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BTB/POZ domain-containing protein KCTD16	A, B, C, D, E	protein	163	Homo sapiens	Q68DU8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>6QB7_1 BTB/POZ domain-containing protein KCTD16 (chains A, B, C, D, E)
SMEIKQSPDEFCHSDFEDASQGSDTRICPPSSLLPADRKWGFITVGYRGSCTLGREGQAD
AKFRRVPRILVCGRISLAKEVFGETLNESRDPDRAPERYTSRFYLKFKHLERAFDMLSEC
GFHMVACNSSVTASFINQYTDDKIWSSYTEYVFYREPSRWSPS

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	15

Primary citation

Structure of the H1 domain of human KCTD16. Pinkas, D.M. To be published.

Other PDB entries of the same protein (UniProt Q68DU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6OCR 2.28 Å, Crystal structure of human KCTD16 T1 domain
6I0Q 2.3 Å, Crystal structure of BTB domain of KCTD16 hexamer
6OCP 2.35 Å, Crystal structure of a human GABAB receptor peptide bound to KCTD16 T1
5A15 2.76 Å, Crystal structure of the BTB domain of human KCTD16
6OCT 2.8 Å, Crystal structure of human KCTD16 T1 domain
6M8R 3.2 Å, Crystal structure of the KCTD16 BTB domain in complex with GABAB2 peptide

Browse structure collections

About this viewer

MolViewer shows 6QB7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.