6QFM: Human Mcl-1

Structure of human Mcl-1 in complex with PUMA BH3 peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 12 Jun 2019.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,367
Mol. weight: 21.4 kDa
Ligands: ZN
Released: 12 Jun 2019

Explore 6QFM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6QFM contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	173-190	18
α-helix	205-223	19
α-helix	225-237	13
α-helix	242-253	12
α-helix	261-280	20
α-helix	284-286	3
α-helix	287-308	22
α-helix	311-319	9

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	132-148	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Induced myeloid leukemia cell differentiation protein Mcl-1	A	protein	162	Homo sapiens	Q07820 (AlphaFold model)
Bcl-2-binding component 3	B	protein	23	Homo sapiens	Q9BXH1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6QFM_1 Induced myeloid leukemia cell differentiation protein Mcl-1 (chains A)
GPLGSEDDLYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHE
TAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQES
FIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGG

Sequence of entity 2 (B), FASTA

>6QFM_2 Bcl-2-binding component 3 (chains B)
RGEEEQWAREIGAQLRRMADDLN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Water and common crystallization additives (CL) are not listed.

Primary citation

Establishing Drug Discovery and Identification of Hit Series for the Anti-apoptotic Proteins, Bcl-2 and Mcl-1. Murray, J.B., Davidson, J., Chen, I. et al. ACS Omega (2019) 4:8892-8906. DOI 10.1021/acsomega.9b00611 · PubMed

Other PDB entries of the same protein (UniProt Q07820 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VJP 1.13 Å, Histidine-covalent stapled alpha-helical peptide (155H1) targeting hMcl-1
9PQ7 1.24 Å, MBP-Mcl1 in complex with ligand 21b
9PQ5 1.28 Å, MBP-Mcl1 in complex with ligand 8
6UDV 1.35 Å, X-ray co-crystal structure of compound 3 bound to human Mcl-1
9UGP 1.39 Å, Crystal structure of MCL-1 in complex with HRK BH3
8G3S 1.4 Å, MBP-Mcl1 in complex with ligand 11
5W89 1.42 Å, Crystal structure of human Mcl-1 in complex with modified Bim BH3 peptide SAH-MS1-18
5C3F 1.43 Å, Crystal structure of Mcl-1 bound to BID-MM
8G3X 1.46 Å, MBP-Mcl1 in complex with ligand 32
8H7B 1.46 Å, The crystal structure of human mcl1 kinase domain in complex with MCL1-M-EBA
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
6OQD 1.48 Å, Crystal structure of Mcl1 with inhibitor 8

Browse structure collections

About this viewer

MolViewer shows 6QFM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.