6QNN: Clathrin heavy chain N-terminal domain

Clathrin heavy chain N-terminal domain bound to GTSE1 lidl motif. Determined by X-ray diffraction at 2.03 Å resolution. Released 28 Aug 2019.

Method: X-ray diffraction
Resolution: 2.03 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,925
Mol. weight: 47.63 kDa
Released: 28 Aug 2019

Explore 6QNN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6QNN contains 11 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	1
α-helix	22-24	3
β-strand	30-34	5	2
β-strand	37-42	6	2
β-strand	48-54	7	2
β-strand	57-66	10	2
β-strand	70-73	4	3
β-strand	79-84	6	3
β-strand	87-92	6	3
β-strand	97-103	7	3
β-strand	110-113	4	4
β-strand	118-122	5	4
β-strand	126-131	6	4
α-helix	138	1
β-strand	139-143	5	4
α-helix	144-145	2
α-helix	146-148	3
β-strand	152-158	7	5
β-strand	164-172	9	5
β-strand	177-185	9	5
β-strand	190-194	5	5
β-strand	198-205	8	6
α-helix	206	1
β-strand	212-222	11	6
β-strand	225-232	8	6
α-helix	235-237	3
α-helix	241-245	5
β-strand	246-250	5	6
β-strand	261-267	7	7
β-strand	272-277	6	7
β-strand	281-286	6	7
β-strand	292-297	6	7
β-strand	303-309	7	1
β-strand	314-319	6	1
β-strand	323-329	7	1
α-helix	334-340	7
α-helix	345-354	10

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	707-709	3
β-strand	710	1	5
α-helix	717-719	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Clathrin heavy chain 1	A	protein	364	Homo sapiens	Q00610 (AlphaFold model)
G2 and S phase-expressed protein 1	B	protein	66	Homo sapiens	Q9NYZ3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6QNN_1 Clathrin heavy chain 1 (chains A)
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELF

Sequence of entity 2 (B), FASTA

>6QNN_2 G2 and S phase-expressed protein 1 (chains B)
SQPLIDLPLIDFCDTPEAHVAVGSESRPLIDLMTNTPDMNKNVAKPSPVVGQLIDLSSPL
IQLSPE

Primary citation

Clathrin's adaptor interaction sites are repurposed to stabilize microtubules during mitosis. Rondelet, A., Lin, Y.C., Singh, D. et al. J Cell Biol (2020) 219. DOI 10.1083/jcb.201907083 · PubMed

Other PDB entries of the same protein (UniProt Q00610 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9C0Y 1.4 Å, Clathrin terminal domain complexed with Pitstop 2c
9C0Z 1.51 Å, Clathrin terminal domain complexed with pitstop 2d
6E4L 1.6 Å, The structure of the N-terminal domain of human clathrin heavy chain 1 (nTD) in complex…
4G55 1.69 Å, Clathrin terminal domain complexed with pitstop 2
2XZG 1.7 Å, Clathrin Terminal Domain Complexed with Pitstop 1
7BN2 1.97 Å, Clathrin heavy chain N-terminal domain bound to Non structured protein 3 from Eastern…
7BN1 1.97 Å, Clathrin heavy chain N-terminal domain complexed with peptide from Protein mu-NS of…
7ZX4 2.08 Å, Clathrin N-terminal domain in complex with a HURP phospho-peptide
6QNP 2.7 Å, Clathrin heavy chain N-terminal domain bound to GTSE1 lidl motif

Browse structure collections

About this viewer

MolViewer shows 6QNN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.