7BN2: Clathrin heavy chain N-terminal domain

Clathrin heavy chain N-terminal domain bound to Non structured protein 3 from Eastern Equine Encephalitis Virus. Determined by X-ray diffraction at 1.97 Å resolution. Released 2 Mar 2022.

Method: X-ray diffraction
Resolution: 1.97 Å
Organisms: Homo sapiens, Eastern equine encephalitis virus
Chains: 4
Atoms: 6,323
Mol. weight: 85.13 kDa
Ligands: PO4
Released: 2 Mar 2022

Explore 7BN2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BN2 contains 22 α-helices and 60 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 11 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	1
α-helix	15-18	4
α-helix	22-24	3
β-strand	30-34	5	2
β-strand	37-44	8	2
β-strand	47-54	8	2
β-strand	62-65	4	2
β-strand	66	1	3
β-strand	70-73	4	4
β-strand	79-84	6	4
β-strand	87-92	6	4
β-strand	97-103	7	4
β-strand	110-113	4	5
β-strand	118-122	5	5
β-strand	126-131	6	5
β-strand	139-143	5	5
α-helix	144-145	2
α-helix	146-148	3
α-helix	151	1
β-strand	152-158	7	6
β-strand	164-173	10	6
β-strand	176-185	10	6
β-strand	190-194	5	6
β-strand	198-204	7	7
β-strand	213-221	9	7
β-strand	226-232	7	7
α-helix	240-245	6
β-strand	246-250	5	7
α-helix	254-256	3
β-strand	261-267	7	8
β-strand	272-277	6	8
β-strand	281-286	6	8
β-strand	292-297	6	8
β-strand	303-309	7	1
α-helix	310-312	3
β-strand	314-319	6	1
β-strand	323-329	7	1
α-helix	334-336	3
α-helix	337-341	5
α-helix	345-354	10

Chain BBB: 11 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	9
α-helix	15-18	4
α-helix	22-24	3
β-strand	30-34	5	10
β-strand	37-44	8	10
β-strand	47-54	8	10
β-strand	62-65	4	10
β-strand	66	1	11
β-strand	70-73	4	12
β-strand	79-84	6	12
β-strand	87-92	6	12
β-strand	97-103	7	12
β-strand	110-113	4	13
β-strand	118-122	5	13
β-strand	126-131	6	13
α-helix	136-138	3
β-strand	139-143	5	13
α-helix	144-145	2
α-helix	146-148	3
α-helix	151	1
β-strand	152-158	7	14
β-strand	164-173	10	14
β-strand	176-185	10	14
β-strand	190-195	6	14
β-strand	198-204	7	15
β-strand	213-222	10	15
β-strand	225-232	8	15
α-helix	240-245	6
β-strand	246-250	5	15
α-helix	254-256	3
β-strand	261-267	7	16
β-strand	272-277	6	16
β-strand	281-286	6	16
β-strand	292-297	6	16
β-strand	303-309	7	9
α-helix	310-312	3
β-strand	314-319	6	9
β-strand	323-329	7	9
α-helix	334-340	7
α-helix	345-354	10

Chains CCC and DDD: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1772	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Clathrin heavy chain 1	AAA, BBB	protein	364	Homo sapiens	Q00610 (AlphaFold model)
Non structured protein 3 from Eastern Equine Encephalitis Virus	CCC, DDD	protein	17	Eastern equine encephalitis virus

Sequence of entity 1 (AAA, BBB), FASTA

>7BN2_1 Clathrin heavy chain 1 (chains AAA, BBB)
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELF

Sequence of entity 2 (CCC, DDD), FASTA

>7BN2_2 Non structured protein 3 from Eastern Equine Encephalitis Virus (chains CCC, DDD)
SDHSVDLITFDSVTDIY

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Large-scale phage-based screening reveals extensive pan-viral mimicry of host short linear motifs. Mihalic, F., Simonetti, L., Giudice, G. et al. Nat Commun (2023) 14. DOI 10.1038/s41467-023-38015-5

Other PDB entries of the same protein (UniProt Q00610 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9C0Y 1.4 Å, Clathrin terminal domain complexed with Pitstop 2c
9C0Z 1.51 Å, Clathrin terminal domain complexed with pitstop 2d
6E4L 1.6 Å, The structure of the N-terminal domain of human clathrin heavy chain 1 (nTD) in complex…
4G55 1.69 Å, Clathrin terminal domain complexed with pitstop 2
2XZG 1.7 Å, Clathrin Terminal Domain Complexed with Pitstop 1
7BN1 1.97 Å, Clathrin heavy chain N-terminal domain complexed with peptide from Protein mu-NS of…
6QNN 2.03 Å, Clathrin heavy chain N-terminal domain bound to GTSE1 lidl motif
7ZX4 2.08 Å, Clathrin N-terminal domain in complex with a HURP phospho-peptide
6QNP 2.7 Å, Clathrin heavy chain N-terminal domain bound to GTSE1 lidl motif

Browse structure collections

About this viewer

MolViewer shows 7BN2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.