7ZX4: Clathrin N-terminal domain

Clathrin N-terminal domain in complex with a HURP phospho-peptide. Determined by X-ray diffraction at 2.08 Å resolution. Released 29 Mar 2023.

Method: X-ray diffraction
Resolution: 2.08 Å
Organism: Homo sapiens
Chains: 5
Atoms: 6,161
Mol. weight: 88.72 kDa
Released: 29 Mar 2023

Explore 7ZX4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ZX4 contains 20 α-helices and 59 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	1
α-helix	15-18	4
α-helix	22-24	3
β-strand	30-34	5	2
β-strand	37-43	7	2
β-strand	48-54	7	2
β-strand	62-66	5	2
β-strand	70-73	4	3
β-strand	79-84	6	3
β-strand	87-92	6	3
β-strand	97-103	7	3
β-strand	110-113	4	4
β-strand	118-122	5	4
β-strand	126-131	6	4
β-strand	139-143	5	4
α-helix	144-145	2
α-helix	146-148	3
α-helix	151	1
β-strand	152-158	7	5
β-strand	164-173	10	5
β-strand	176-185	10	5
β-strand	190-195	6	5
β-strand	198-204	7	6
β-strand	213-222	10	6
β-strand	225-232	8	6
α-helix	235-237	3
α-helix	240-245	6
β-strand	246-250	5	6
β-strand	261-267	7	7
β-strand	272-277	6	7
β-strand	281-286	6	7
β-strand	292-297	6	7
β-strand	303-309	7	1
α-helix	310-312	3
β-strand	314-319	6	1
β-strand	323-329	7	1
α-helix	334-340	7
α-helix	345-354	10

Chain B: 10 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	8
α-helix	15-18	4
α-helix	22-24	3
β-strand	30-34	5	9
β-strand	37-44	8	9
β-strand	47-54	8	9
β-strand	62-65	4	9
β-strand	66	1	10
β-strand	70-73	4	11
β-strand	79-84	6	11
β-strand	87-92	6	11
β-strand	97-103	7	11
β-strand	110-113	4	12
β-strand	118-122	5	12
β-strand	126-131	6	12
β-strand	139-143	5	12
α-helix	144-145	2
α-helix	146-148	3
α-helix	151	1
β-strand	152-158	7	13
β-strand	164-173	10	13
β-strand	176-185	10	13
β-strand	190-195	6	13
β-strand	198-204	7	14
β-strand	213-221	9	14
β-strand	226-232	7	14
α-helix	235-237	3
α-helix	240-245	6
β-strand	246-250	5	14
β-strand	261-267	7	15
β-strand	272-277	6	15
β-strand	281-286	6	15
β-strand	292-297	6	15
β-strand	303-309	7	8
α-helix	310-312	3
β-strand	314-319	6	8
β-strand	323-329	7	8
α-helix	334-340	7
α-helix	345-353	9

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	11	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Clathrin heavy chain 1	A, B	protein	364	Homo sapiens	Q00610 (AlphaFold model)
Disks large-associated protein 5	C, D, E	protein	21	Homo sapiens	Q15398 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7ZX4_1 Clathrin heavy chain 1 (chains A, B)
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELF

Sequence of entity 2 (C, D, E), FASTA

>7ZX4_2 Disks large-associated protein 5 (chains C, D, E)
YRHISFGGNLITFSPLQPGEF

Primary citation

Large-scale phosphomimetic screening identifies phospho-modulated motif-based protein interactions. Kliche, J., Garvanska, D.H., Simonetti, L. et al. Mol Syst Biol (2023) 19:e11164-e11164. DOI 10.15252/msb.202211164 · PubMed

Other PDB entries of the same protein (UniProt Q00610 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9C0Y 1.4 Å, Clathrin terminal domain complexed with Pitstop 2c
9C0Z 1.51 Å, Clathrin terminal domain complexed with pitstop 2d
6E4L 1.6 Å, The structure of the N-terminal domain of human clathrin heavy chain 1 (nTD) in complex…
4G55 1.69 Å, Clathrin terminal domain complexed with pitstop 2
2XZG 1.7 Å, Clathrin Terminal Domain Complexed with Pitstop 1
7BN2 1.97 Å, Clathrin heavy chain N-terminal domain bound to Non structured protein 3 from Eastern…
7BN1 1.97 Å, Clathrin heavy chain N-terminal domain complexed with peptide from Protein mu-NS of…
6QNN 2.03 Å, Clathrin heavy chain N-terminal domain bound to GTSE1 lidl motif
6QNP 2.7 Å, Clathrin heavy chain N-terminal domain bound to GTSE1 lidl motif

Browse structure collections

About this viewer

MolViewer shows 7ZX4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.