6R4R: PI3-Kinase SH3 Domain Amyloid Fibril

Cryo-EM Structure of the PI3-Kinase SH3 Domain Amyloid Fibril. Determined by electron microscopy at 3.4 Å resolution. Released 28 Aug 2019.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Bos taurus
Chains: 7
Atoms: 4,312
Mol. weight: 67.55 kDa
Released: 28 Aug 2019

Explore 6R4R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6R4R contains 0 α-helices and 63 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F and G: 0 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	1
β-strand	15-19	5	2
β-strand	23-25	3	3
β-strand	29-34	6	4
β-strand	37-41	5	5
β-strand	45	1	6
β-strand	51-56	6	7
β-strand	61-68	8	8
β-strand	71-76	6	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 3-kinase regulatory subunit alpha	A, B, C, D, E, F, G	protein	86	Bos taurus	P23727 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>6R4R_1 Phosphatidylinositol 3-kinase regulatory subunit alpha (chains A, B, C, D, E, F, G)
GSMSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEAKPEEIGWLNG
YNETTGERGDFPGTYVEYIGRKKISP

Primary citation

Atomic structure of PI3-kinase SH3 amyloid fibrils by cryo-electron microscopy. Roder, C., Vettore, N., Mangels, L.N. et al. Nat Commun (2019) 10:3754-3754. DOI 10.1038/s41467-019-11320-8 · PubMed

Other PDB entries of the same protein (UniProt P23727 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QAD 1.8 Å, Crystal Structure of the C-Terminal SH2 Domain of the P85 alpha Regulatory Subunit of…
6D85 2.2 Å, Structure of the Bovine p85a BH domain E217K mutant
6D81 2.25 Å, Structure of the Bovine p85a BH domain
8S3R 2.28 Å, Human PI3KDELTA in complex with pyridazinone inhibitor 7
6D86 2.3 Å, Structure of the Bovine p85a BH domain
6MRP 2.4 Å, Structure of the Bovine p85a BH domain R228E mutant
6D82 2.41 Å, Structure of the Bovine p85a BH domain
7JIS 2.42 Å, Human PI3KDELTA in complex with compound 2F
8BCY 2.43 Å, Human PI3KDELTA in complex with compound 13
9L3R 2.5 Å, Human PI3KDELTA in complex with Zandelisib
6OCO 2.58 Å, Human PI3KDELTA in complex with compound 6
5DXU 2.64 Å, p110delta/p85alpha with GDC-0326

Browse structure collections

About this viewer

MolViewer shows 6R4R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.