Crystal structure of InhA in complex with AP-124 inhibitor. Determined by X-ray diffraction at 1.75 Å resolution. Released 25 Dec 2019.
Explore 6R9W in 3D Show helices and sheets RCSB PDB PDBe
6R9W contains 86 α-helices and 42 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 1 |
| α-helix | 21-31 | 11 | |
| α-helix | 34 | 1 | |
| β-strand | 35-40 | 6 | 1 |
| α-helix | 44-51 | 8 | |
| β-strand | 60-62 | 3 | 1 |
| α-helix | 68-82 | 15 | |
| β-strand | 88-93 | 6 | 1 |
| α-helix | 108-110 | 3 | |
| α-helix | 113-120 | 8 | |
| α-helix | 121-125 | 5 | |
| α-helix | 126-134 | 9 | |
| α-helix | 135-137 | 3 | |
| β-strand | 138-148 | 11 | 1 |
| α-helix | 159-180 | 22 | |
| β-strand | 185-191 | 7 | 1 |
| α-helix | 197-203 | 7 | |
| α-helix | 209-225 | 17 | |
| α-helix | 236-246 | 11 | |
| β-strand | 256-260 | 5 | 1 |
| α-helix | 264-266 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 2 |
| α-helix | 21-31 | 11 | |
| α-helix | 34 | 1 | |
| β-strand | 35-40 | 6 | 2 |
| α-helix | 44-51 | 8 | |
| β-strand | 60-62 | 3 | 2 |
| α-helix | 68-82 | 15 | |
| β-strand | 88-93 | 6 | 2 |
| α-helix | 108-110 | 3 | |
| α-helix | 113-120 | 8 | |
| α-helix | 121-125 | 5 | |
| α-helix | 126-134 | 9 | |
| α-helix | 135-137 | 3 | |
| β-strand | 138-148 | 11 | 2 |
| α-helix | 159-180 | 22 | |
| β-strand | 185-191 | 7 | 2 |
| α-helix | 192-193 | 2 | |
| α-helix | 197-203 | 7 | |
| α-helix | 209-225 | 17 | |
| α-helix | 236-246 | 11 | |
| β-strand | 256-260 | 5 | 2 |
| α-helix | 264-266 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 3 |
| α-helix | 21-31 | 11 | |
| α-helix | 34 | 1 | |
| β-strand | 35-40 | 6 | 3 |
| α-helix | 44-51 | 8 | |
| β-strand | 60-62 | 3 | 3 |
| α-helix | 68-82 | 15 | |
| β-strand | 88-93 | 6 | 3 |
| α-helix | 108-110 | 3 | |
| α-helix | 113-120 | 8 | |
| α-helix | 121-125 | 5 | |
| α-helix | 126-134 | 9 | |
| α-helix | 135-137 | 3 | |
| β-strand | 138-148 | 11 | 3 |
| α-helix | 160-180 | 21 | |
| β-strand | 185-191 | 7 | 3 |
| α-helix | 197-203 | 7 | |
| α-helix | 208-225 | 18 | |
| α-helix | 236-246 | 11 | |
| β-strand | 256-260 | 5 | 3 |
| α-helix | 264-266 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 6 |
| α-helix | 21-31 | 11 | |
| α-helix | 34 | 1 | |
| β-strand | 35-40 | 6 | 6 |
| α-helix | 44-51 | 8 | |
| β-strand | 60-62 | 3 | 6 |
| α-helix | 68-82 | 15 | |
| β-strand | 88-93 | 6 | 6 |
| α-helix | 108-110 | 3 | |
| α-helix | 113-120 | 8 | |
| α-helix | 121-125 | 5 | |
| α-helix | 126-134 | 9 | |
| α-helix | 135-137 | 3 | |
| β-strand | 138-148 | 11 | 6 |
| α-helix | 159-180 | 22 | |
| β-strand | 185-191 | 7 | 6 |
| α-helix | 192-193 | 2 | |
| α-helix | 221-225 | 5 | |
| α-helix | 236-246 | 11 | |
| β-strand | 256-260 | 5 | 6 |
| α-helix | 264-266 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Enoyl-[acyl-carrier-protein] reductase [NADH] | A, B, C, D, E, F | protein | 272 | Mycobacterium tuberculosis H37Rv | P9WGR1 (AlphaFold model) |
>6R9W_1 Enoyl-[acyl-carrier-protein] reductase [NADH] (chains A, B, C, D, E, F) GSHMTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAK APLLELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVS KGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAR EAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATP VAKTVCALLSDWLPATTGDIIYADGGAHTQLL
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAD | Nicotinamide-adenine-dinucleotide | C21 H27 N7 O14 P2 | 6 |
| JVZ | (2~{S})-1-(benzimidazol-1-yl)-3-(2,3-dihydro-1~{H}-inden-5-yloxy)propan-2-ol | C19 H20 N2 O2 | 1 |
Discovery of New and Potent InhA Inhibitors as Antituberculosis Agents: Structure-Based Virtual Screening Validated by Biological Assays and X-ray Crystallography. Kamsri, P., Hanwarinroj, C., Phusi, N. et al. J Chem Inf Model (2020) 60:226-234. DOI 10.1021/acs.jcim.9b00918 · PubMed
Other PDB entries of the same protein (UniProt P9WGR1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6R9W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.