6S8X: Rab-binding domain of FIP2

Crystal structure of the Rab-binding domain of FIP2. Determined by X-ray diffraction at 2.29 Å resolution. Released 5 Aug 2020.

Method: X-ray diffraction
Resolution: 2.29 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,791
Mol. weight: 36.6 kDa
Ligands: HEZ
Released: 5 Aug 2020

Explore 6S8X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6S8X contains 9 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	446-490	45
α-helix	492-495	4

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	447-490	44
α-helix	492-496	5

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	449-452	4
α-helix	453-490	38
α-helix	492-495	4

Chain E: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	453-490	38
α-helix	492-495	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rab11 family-interacting protein 2	A, B, D, E	protein	78	Homo sapiens	Q7L804 (AlphaFold model)

Sequence of entity 1 (A, B, D, E), FASTA

>6S8X_1 Rab11 family-interacting protein 2 (chains A, B, D, E)
GSHMSNPFDATAGYRSLTYEEVLQELVKHKELLRRKDTHIRELEDYIDNLLVRVMEETPS
ILRVPYEPSRKAGKFSNS

Ligands and cofactors

ID	Name	Formula	Copies
HEZ	Hexane-1,6-diol	C6 H14 O2	1

Primary citation

Crystal structure of the Rab-binding domain of Rab11 family-interacting protein 2. Kearney, A.M., Khan, A.R. Acta Crystallogr F Struct Biol Commun (2020) 76:357-363. DOI 10.1107/S2053230X20009164 · PubMed

Other PDB entries of the same protein (UniProt Q7L804 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TSO 1.8 Å, Structure of the cancer associated Rab25 protein in complex with FIP2
4C4P 2.0 Å, Crystal Structure of Wild-Type Rab11 Complexed to FIP2
2GZD 2.44 Å, Crystal Structure of Rab11 in Complex with Rab11-FIP2
2GZH 2.47 Å, Crystal Structure of Rab11 in Complex with Rab11-Family Interacting Protein 2
2K6S Structure of Rab11-FIP2 C-terminal Coiled-coil Domain

Browse structure collections

About this viewer

MolViewer shows 6S8X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.