dAb3/HOIP-RBR-Ligand2. Determined by X-ray diffraction at 2.1 Å resolution. Released 27 Nov 2019.
Explore 6SC5 in 3D Show helices and sheets RCSB PDB PDBe
6SC5 contains 25 α-helices and 43 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 698 | 1 | 1 |
| β-strand | 705 | 1 | 1 |
| α-helix | 708-710 | 3 | |
| β-strand | 712-713 | 2 | 2 |
| β-strand | 720-721 | 2 | 2 |
| α-helix | 723-735 | 13 | |
| α-helix | 739-741 | 3 | |
| α-helix | 759-772 | 14 | |
| α-helix | 775-785 | 11 | |
| α-helix | 786-790 | 5 | |
| β-strand | 796-798 | 3 | 3 |
| β-strand | 805-807 | 3 | 3 |
| β-strand | 814-816 | 3 | 4 |
| β-strand | 823-825 | 3 | 4 |
| α-helix | 830 | 1 | |
| β-strand | 831 | 1 | 4 |
| α-helix | 832 | 1 | |
| α-helix | 834-836 | 3 | |
| α-helix | 841-849 | 9 | |
| α-helix | 853-858 | 6 | |
| α-helix | 860-866 | 7 | |
| β-strand | 869-870 | 2 | 5 |
| β-strand | 877-878 | 2 | 5 |
| β-strand | 887-889 | 3 | 6 |
| β-strand | 896-898 | 3 | 6 |
| β-strand | 904 | 1 | 6 |
| β-strand | 905-906 | 2 | 7 |
| β-strand | 923-924 | 2 | 7 |
| α-helix | 931-934 | 4 | |
| α-helix | 939-948 | 10 | |
| β-strand | 972-977 | 6 | 8 |
| β-strand | 980-985 | 6 | 8 |
| α-helix | 999-1012 | 14 | |
| α-helix | 1017-1020 | 4 | |
| α-helix | 1023-1029 | 7 | |
| α-helix | 1030-1034 | 5 | |
| α-helix | 1040-1041 | 2 | |
| α-helix | 1046-1060 | 15 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 9 |
| β-strand | 11-12 | 2 | 10 |
| β-strand | 18-25 | 8 | 9 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-39 | 6 | 11 |
| β-strand | 45-51 | 7 | 11 |
| β-strand | 58-60 | 3 | 11 |
| β-strand | 65 | 1 | 9 |
| β-strand | 68-73 | 6 | 9 |
| β-strand | 78-83 | 6 | 9 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-99 | 8 | 11 |
| β-strand | 107-110 | 4 | 11 |
| β-strand | 114-116 | 3 | 11 |
| β-strand | 117-118 | 2 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 12 |
| β-strand | 11-12 | 2 | 13 |
| β-strand | 18-25 | 8 | 12 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-39 | 6 | 11 |
| β-strand | 45-51 | 7 | 11 |
| β-strand | 58-60 | 3 | 11 |
| α-helix | 62-64 | 3 | |
| β-strand | 68-73 | 6 | 12 |
| β-strand | 78-83 | 6 | 12 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-99 | 8 | 11 |
| β-strand | 107-110 | 4 | 11 |
| β-strand | 114-116 | 3 | 11 |
| β-strand | 117-118 | 2 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase RNF31 | A | protein | 376 | Homo sapiens | Q96EP0 (AlphaFold model) |
| Single domain antibody | B, C | protein | 120 | synthetic construct |
>6SC5_1 E3 ubiquitin-protein ligase RNF31 (chains A) QECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDT QLLSYFSTLDIQLRESLEPDAYALFHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEAT CPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKF SYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRD WTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRVIEQKEVPNGLRDEACGKETPAGYAG LCQAHYKEYLVSLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQARLLQK LTEEVPLGQSIPRRRK
>6SC5_2 Single domain antibody (chains B, C) EVQLLESGGGLVQPGGSLRLSCAASGFTFRGYSMAWVRQAPGKGLEWVSTISPIGTYTYY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGSYSRGTPFDYWGQGTLVTVSS
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 8 |
| L6B | methyl 4-[(2-oxidanylidene-5,6,7,8-tetrahydro-1~{H}-quinolin-3-yl)carbonylamino… | C15 H18 N2 O4 | 1 |
Water and common crystallization additives (CL, SO4) are not listed.
Single-Domain Antibodies as Crystallization Chaperones to Enable Structure-Based Inhibitor Development for RBR E3 Ubiquitin Ligases. Tsai, Y.I., Johansson, H., Dixon, D. et al. Cell Chem Biol (2020) 27:83. DOI 10.1016/j.chembiol.2019.11.007 · PubMed
Other PDB entries of the same protein (UniProt Q96EP0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6SC5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.