9B0B: Optineurin

Structure of Optineurin bound to HOIP NZF1 domain. Determined by X-ray diffraction at 1.7 Å resolution. Released 31 Jul 2024.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 6
Atoms: 3,638
Mol. weight: 52.83 kDa
Ligands: ZN
Released: 31 Jul 2024

Explore 9B0B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9B0B contains 10 α-helices and 8 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	421-468	48
α-helix	470-502	33

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	420-500	81

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	421-501	81

Chain D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	421-458	38
α-helix	461-501	41

Chains E and G: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	354-355	2	3
α-helix	361	1
β-strand	362-363	2	3
α-helix	364	1
β-strand	369	1	4
β-strand	376	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Optineurin	A, B, C, D	protein	96	Homo sapiens	Q96CV9 (AlphaFold model)
E3 ubiquitin-protein ligase RNF31	E, G	protein	30	Homo sapiens	Q96EP0 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>9B0B_1 Optineurin (chains A, B, C, D)
GPDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYSEDFH
AERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQ

Sequence of entity 2 (E, G), FASTA

>9B0B_2 E3 ubiquitin-protein ligase RNF31 (chains E, G)
ARGRWACQSCTFENEAAAVLCSICERPRLA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (PGE, PG4) are not listed.

Primary citation

Linkage and substrate specificity conferred by NZF ubiquitin binding domains. Michel, M.A., Scutts, S., Komander, D. To be published.

Other PDB entries of the same protein (UniProt Q96CV9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VTV 1.7 Å, Crystal structure of Optineurin LIR-fused human LC3B_2-119
9B12 1.81 Å, Structure of Optineurin bound to HOIP NZF1 domain and M1-linked diubiquitin, crystal…
9M0O 1.83 Å, Crystal structure of OPTN 138-170 in complex with GTP-bound RAB8A1-176 (Q67L)
9IKQ 1.93 Å, Crystal structure of OPTN LZD in complex with GTP-bound Rab8a(Q67L)
7CZM 2.0 Å, Crystal structure of FIP200 Claw/p-OPtineurin LIR complex
5EOF 2.05 Å, Crystal structure of OPTN NTD and TBK1 CTD complex
9B0Z 2.41 Å, Structure of Optineurin bound to HOIP NZF1 domain and M1-linked diubiquitin, crystal…
5EOA 2.5 Å, Crystal structure of OPTN E50K mutant and TBK1 complex
3VTW 2.52 Å, Crystal structure of T7-tagged Optineurin LIR-fused human LC3B_2-119
5B83 2.69 Å, Crystal structure of Optineurin UBAN in complex with linear ubiquitin
2LO4 NMR Solution Structure of Optineurin Zinc-finger Domain
2LUE LC3B OPTN-LIR Ptot complex structure

Browse structure collections

About this viewer

MolViewer shows 9B0B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.