6SFB: EED

EED in complex with a triazolopyrimidine. Determined by X-ray diffraction at 1.52 Å resolution. Released 25 Sept 2019.

Method: X-ray diffraction
Resolution: 1.52 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,356
Mol. weight: 85.53 kDa
Ligands: L9W
Released: 25 Sept 2019

Explore 6SFB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SFB contains 9 α-helices and 58 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	83-89	7	1
α-helix	94-95	2
β-strand	96-101	6	2
α-helix	106	1
β-strand	111-117	7	2
β-strand	120-126	7	2
α-helix	128-130	3
β-strand	132-139	8	2
β-strand	147-154	8	3
β-strand	161-167	7	3
β-strand	172-176	5	3
β-strand	181-186	6	3
β-strand	193-198	6	4
β-strand	205-210	6	4
β-strand	215-219	5	4
β-strand	224-229	6	4
β-strand	239-244	6	5
β-strand	250-255	6	5
β-strand	260-264	5	5
α-helix	268-279	12
α-helix	288-289	2
β-strand	292-294	3	4
β-strand	299-301	3	5
β-strand	311-315	5	6
β-strand	318-322	5	6
β-strand	327-333	7	6
β-strand	350-357	8	6
β-strand	368-370	3	7
β-strand	376-380	5	7
β-strand	386-390	5	7
β-strand	402-404	3	7
β-strand	413-418	6	1
β-strand	424-429	6	1
β-strand	433-438	6	1

Chain B: 4 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	83-89	7	8
α-helix	94-95	2
β-strand	96-101	6	9
α-helix	106	1
β-strand	111-117	7	9
β-strand	120-126	7	9
α-helix	128-130	3
β-strand	132-139	8	9
β-strand	147-154	8	10
β-strand	161-167	7	10
β-strand	171-176	6	10
β-strand	181-187	7	10
β-strand	193-198	6	11
β-strand	205-210	6	11
β-strand	215-219	5	11
β-strand	224-229	6	11
β-strand	239-244	6	12
β-strand	250-255	6	12
β-strand	260-264	5	12
α-helix	268-278	11
β-strand	292-294	3	11
β-strand	299-301	3	12
β-strand	311-315	5	13
β-strand	318-322	5	13
β-strand	327-333	7	13
β-strand	350-357	8	13
β-strand	368-370	3	14
β-strand	376-380	5	14
β-strand	386-390	5	14
β-strand	402-404	3	14
β-strand	413-418	6	8
β-strand	424-429	6	8
β-strand	433-438	6	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polycomb protein EED	A, B	protein	366	Homo sapiens	O75530 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6SFB_1 Polycomb protein EED (chains A, B)
KKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLL
QSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINE
LKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCG
MDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWL
GDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQK
MLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIW
RWDRLR

Ligands and cofactors

ID	Name	Formula	Copies
L9W	N-(2,3-dihydro-1-benzofuran-4-ylmethyl)-8-(4-methylsulfonylphenyl)-[1,2,4]triaz…	C21 H19 N5 O3 S	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Rapid Identification of Novel Allosteric PRC2 Inhibitors. Read, J.A., Tart, J., Rawlins, P.B. et al. ACS Chem Biol (2019) 14:2134-2140. DOI 10.1021/acschembio.9b00468 · PubMed

Other PDB entries of the same protein (UniProt O75530 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5U69 1.28 Å, Polycomb protein EED in complex with inhibitor: (3R,4S)-1-[(2-methoxyphenyl)methyl]-N,N-d…
5U8F 1.34 Å, Polycomb protein EED in complex with inhibitor: (3R,4S)-1-[(1S)-7-fluoro-2,3-dihydro-1H-i…
5U8A 1.45 Å, Polycomb protein EED in complex with inhibitor: (3R,4S)-1-[(2-bromo-6-fluorophenyl)methyl…
3K26 1.58 Å, Complex structure of EED and trimethylated H3K4
5U5T 1.6 Å, Crystal structure of EED in complex with H3K27Me3 peptide and…
7QK4 1.6 Å, EED in complex with PRC2 allosteric inhibitor compound 22 (MAK683)
7P3C 1.61 Å, EED in complex with compound 4
6V3Y 1.63 Å, Crystal structure of EED in complex with PALI1-K1219me3 peptide
5U6D 1.64 Å, Polycomb protein EED in complex with inhibitor: 2-[4-(4-{(3S,4R)-4-(dimethylamino)-1-[(2-…
6V3X 1.7 Å, Crystal structure of EED in complex with PALI1-K1241me3 peptide
5TTW 1.74 Å, Crystal Structure of EED in Complex with UNC4859
7SI5 1.75 Å, Crystal structure of eed with mrtx-1919

Browse structure collections

About this viewer

MolViewer shows 6SFB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.