6SJV: HPV18 E6 oncoprotein

Structure of HPV18 E6 oncoprotein in complex with mutant E6AP LxxLL motif. Determined by X-ray diffraction at 2.03 Å resolution. Released 4 Sept 2019.

Method: X-ray diffraction
Resolution: 2.03 Å
Organisms: Escherichia coli, Human papillomavirus type 18, Homo sapiens
Chains: 1
Atoms: 4,307
Mol. weight: 61.12 kDa
Ligands: ZN
Released: 4 Sept 2019

Explore 6SJV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SJV contains 39 α-helices and 36 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 39 helices, 36 β-strands

Element	Residues	Length	Sheet
α-helix	3-4	2
β-strand	7-11	5	1
α-helix	18-32	15
β-strand	35-39	5	1
α-helix	44-52	9
β-strand	60-64	5	1
α-helix	65-67	3
α-helix	68-73	6
β-strand	77	1	2
α-helix	78-80	3
α-helix	84-87	4
β-strand	90	1	3
α-helix	92-97	6
β-strand	99-100	2	4
β-strand	103-104	2	4
β-strand	107-112	6	1
β-strand	115-119	5	5
β-strand	129	1	6
α-helix	133-142	10
β-strand	146-148	3	5
α-helix	155-164	10
α-helix	168	1
β-strand	169-173	5	7
β-strand	176-180	5	7
α-helix	187-201	15
α-helix	211-219	9
β-strand	223-228	6	5
α-helix	230-232	3
α-helix	233-238	6
β-strand	243-246	4	5
α-helix	247-249	3
β-strand	250-251	2	6
β-strand	254-255	2	6
α-helix	256	1
α-helix	258	1
β-strand	259-260	2	8
β-strand	261-267	7	1
β-strand	268	1	2
α-helix	274-280	7
α-helix	281-285	5
α-helix	288-297	10
β-strand	302-303	2	1
β-strand	305	1	3
α-helix	306-308	3
α-helix	309-312	4
α-helix	316-327	12
β-strand	329-330	2	8
α-helix	331-332	2
α-helix	337-352	16
α-helix	358-1002	16
α-helix	1003-1005	3
β-strand	1013	1	9
α-helix	1014-1020	7
β-strand	1031-1032	2	10
α-helix	1037	1
β-strand	1038	1	10
α-helix	1039-1040	2
α-helix	1041-1049	9
β-strand	1053	1	9
β-strand	1055-1057	3	10
β-strand	1060-1063	4	10
α-helix	1066-1079	14
β-strand	1081-1085	5	11
α-helix	1087-1094	8
β-strand	1104	1	12
β-strand	1105	1	13
α-helix	1110	1
β-strand	1111	1	12
α-helix	1112-1113	2
α-helix	1114-1122	9
β-strand	1127-1130	4	11
β-strand	1133-1135	3	11
β-strand	1136	1	13
α-helix	1139-1142	4
α-helix	2382-2389	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltodextrin-binding protein,Protein E6,Ubiquitin-protein ligase E3A	A	protein	543	Escherichia coli, Human papillomavirus type 18, Homo sapiens	P06463 (AlphaFold model), Q05086 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6SJV_1 Maltodextrin-binding protein,Protein E6,Ubiquitin-protein ligase E3A (chains A)
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDI
IFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNK
DLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIK
DVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSA
VNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPL
GAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDA
ALAAAQTNAAAMARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAR
KDLFVVYRDSIPHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRCQ
KPLNPAEKLRHLNEKRRFHNIAGHYRGQCHSCCNRARQERLQRGSAAAESSELTFQELLG
ERR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Cellular target recognition by HPV18 and HPV49 oncoproteins. Suarez, I.P., Bonhoure, A., Cousido-Siah, A. et al. To be published.

Other PDB entries of the same protein (UniProt P06463 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JOR 1.34 Å, CFTR Associated Ligand (CAL) PDZ domain bound to HPV18 E6 oncoprotein C-terminal peptide…
5K4F 1.36 Å, CAL PDZ mutant C319A with a peptide
5IC3 1.7 Å, CAL PDZ domain with peptide and inhibitor
6ZFG 1.85 Å, 14-3-3 zeta chimera with 18E6 and fusicoccin
8OEP 1.87 Å, Crystal structure of the PTPN3 PDZ domain bound to the HPV18 E6 oncoprotein C-terminal…
6ZFD 1.9 Å, 14-3-3 zeta bound to the phosphorylated 18E6 C-terminus
2I04 2.15 Å, X-ray crystal structure of MAGI-1 PDZ1 bound to the C-terminal peptide of HPV18 E6
2I0L 2.31 Å, X-ray crystal structure of Sap97 PDZ2 bound to the C-terminal peptide of HPV18 E6.
2I0I 2.8 Å, X-ray crystal structure of Sap97 PDZ3 bound to the C-terminal peptide of HPV18 E6
8B82 2.8 Å, Crystal structure of Scribble PDZ1 with human papillomavirus strain 16 E6 peptide

Browse structure collections

About this viewer

MolViewer shows 6SJV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.