6ST2: Bcl-2-like protein 1

Selective Affimers Recognize BCL-2 Family Proteins Through Non-Canonical Structural Motifs. Determined by X-ray diffraction at 1.79 Å resolution. Released 30 Sept 2020.

Method: X-ray diffraction
Resolution: 1.79 Å
Organisms: Homo sapiens, synthetic construct
Chains: 4
Atoms: 3,861
Mol. weight: 56.63 kDa
Released: 30 Sept 2020

Explore 6ST2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ST2 contains 21 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	3-19	17
α-helix	26-44	19
α-helix	46-53	8
α-helix	64-74	11
α-helix	81-100	20
α-helix	105-117	13
α-helix	118-122	5
α-helix	123-128	6
α-helix	131-139	9

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	3-19	17
α-helix	26-44	19
α-helix	46-53	8
α-helix	64-72	9
α-helix	73-75	3
α-helix	81-100	20
α-helix	106-117	12
α-helix	118-122	5
α-helix	123-128	6
α-helix	131-139	9

Chains C and D: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
α-helix	5-22	18
β-strand	27-40	14	1
β-strand	44-57	14	1
β-strand	60-73	14	1
β-strand	82-89	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2-like protein 1	A, B	protein	153	Homo sapiens	Q07817 (AlphaFold model)
Affimer AF6	C, D	protein	91	synthetic construct

Sequence of entity 1 (A, B), FASTA

>6ST2_1 Bcl-2-like protein 1 (chains A, B)
MSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQLHITP
GTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLND
HLEPWIQENGGWDTFVELYGNNAAAESRKGQER

Sequence of entity 2 (C, D), FASTA

>6ST2_2 Affimer AF6 (chains C, D)
SENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQERNSIFEEFTMYYLTLEAKDGGK
KKLYEAKVWVKRDLVFGGPENFKELQEFKPV

Primary citation

Selective Affimers Recognise the BCL-2 Family Proteins BCL-x L and MCL-1 through Noncanonical Structural Motifs*. Miles, J.A., Hobor, F., Trinh, C.H. et al. Chembiochem (2021) 22:232-240. DOI 10.1002/cbic.202000585 · PubMed

Other PDB entries of the same protein (UniProt Q07817 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7JGW 1.3 Å, Crystal structure of BCL-XL in complex with COMPOUND 1620116, CRYSTAL FORM 1
3SP7 1.4 Å, Crystal Structure of Bcl-xL bound to BM903
7YAA 1.4 Å, Crystal structure analysis of cp3 bound BCLxl
7LH7 1.41 Å, Crystal structure of BCL-XL in complex with a benzothiazole-based inhibitor
9IGG 1.5 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
4QVF 1.53 Å, Crystal structure of Bcl-xL in complex with BIM BH3 domain
4A1U 1.54 Å, Crystal structure of alpha-beta-foldamer 2c in complex with Bcl-xL
6VWC 1.6 Å, Crystal structure of Bcl-xL in complex with tetrahydroisoquinoline-pyridine based…
6O0K 1.62 Å, crystal structure of BCL-2 with venetoclax
3SPF 1.7 Å, Crystal Structure of Bcl-xL bound to BM501
9I9E 1.7 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
9O14 1.73 Å, Crystal Structure of BCL-2 in complex with a stapled BAD BH3 peptide BAD SAHB 4.2

Browse structure collections

About this viewer

MolViewer shows 6ST2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.