6ST6: Domain Swapped Trp Repressor V58I Variant

Crystal Structure of Domain Swapped Trp Repressor V58I Variant. Determined by X-ray diffraction at 2.05 Å resolution. Released 30 Sept 2020.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Escherichia coli (strain K12)
Chains: 1
Atoms: 920
Mol. weight: 12.75 kDa
Ligands: IPA
Released: 30 Sept 2020

Explore 6ST6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ST6 contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	6-31	26
α-helix	35-42	8
α-helix	45-91	47
α-helix	94-103	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Trp operon repressor	A	protein	108	Escherichia coli (strain K12)	P0A881 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6ST6_1 Trp operon repressor (chains A)
GPMAQQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRII
EELLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLW

Ligands and cofactors

ID	Name	Formula	Copies
IPA	Isopropyl alcohol	C3 H8 O	6

Primary citation

Crystal structures of Val58Ile tryptophan repressor in a domain-swapped array in the presence and absence of L-tryptophan. Sprenger, J., Lawson, C.L., von Wachenfeldt, C. et al. Acta Crystallogr F Struct Biol Commun (2021) 77:215-225. DOI 10.1107/S2053230X21006142 · PubMed

Other PDB entries of the same protein (UniProt P0A881 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ENI 1.1 Å, Tryptophan Repressor TrpR from E.coli variant T44L S88Y with Indole-3-acetic acid as…
6ENN 1.17 Å, Tryptophan Repressor TrpR from E.coli variant T44L T81M N87G S88Y with Indole-3-acetic…
6FAL 1.2 Å, Tryptophan Repressor TrpR from E.coli with 3-Indolepropionic acid as ligand
1JHG 1.3 Å, Trp repressor mutant V58I
6ELG 1.38 Å, Tryptophan Repressor TrpR from E.coli variant M42F T44L T81I S88Y with…
6F9K 1.4 Å, Tryptophan Repressor TrpR from E.coli with 5-methyl-L-tryptophan as ligand
6ELB 1.44 Å, Tryptophan Repressor TrpR from E.coli variant M42F T44L T81M N87G S88Y with…
6EKP 1.46 Å, Tryptophan Repressor TrpR from E.coli variant T44L T81M S88Y with Indole-3-acetic acid…
3SSX 1.58 Å, E. coli trp aporeporessor L75F mutant
2OZ9 1.65 Å, E. coli TRP holorepressor, orthorhombic crystal form
6F7G 1.66 Å, Tryptophan Repressor TrpR from E.coli with 5-Methyltryptamine
3SSW 1.67 Å, E. coli trp aporepressor

Browse structure collections

About this viewer

MolViewer shows 6ST6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.