6T1S: PPAR mutant

PPAR mutant. Determined by X-ray diffraction at 1.65 Å resolution. Released 14 Apr 2021.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,518
Mol. weight: 32.49 kDa
Ligands: EDK
Released: 14 Apr 2021

Explore 6T1S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6T1S contains 15 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	234-253	20
α-helix	258-265	8
α-helix	274	1
β-strand	275-277	3	1
α-helix	280-285	6
α-helix	301-329	29
α-helix	334-336	3
α-helix	339-360	22
β-strand	362	1	1
β-strand	366-369	4	1
α-helix	370-372	3
β-strand	374-377	4	1
α-helix	378-382	5
α-helix	388-390	3
α-helix	393-403	11
α-helix	409-420	12
α-helix	431-452	22
α-helix	459-487	29
α-helix	495-501	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peroxisome proliferator-activated receptor gamma	A	protein	279	Homo sapiens	P37231 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6T1S_1 Peroxisome proliferator-activated receptor gamma (chains A)
GSHMQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMG
EDKIKFKHITPLQEQSKEVAIRISQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLL
KYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALE
LDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQK
MTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY

Ligands and cofactors

ID	Name	Formula	Copies
EDK	(2~{S})-3-[4-[2-[methyl(pyridin-2-yl)amino]ethoxy]phenyl]-2-[[2-(phenylcarbonyl…	C30 H29 N3 O4	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structure of PPARg mutant. Rochel, N. To be published.

Other PDB entries of the same protein (UniProt P37231 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9F7W 1.25 Å, Human PPARgamma ligand binding domain in complex with co-activator 1alpha peptide and…
8BF1 1.36 Å, High-resolution structure of unliganded PPAR gamma in complex with the peptide PGC-1 alpha
9V8G 1.39 Å, PPARgamma ligand-binding domain in complex with PG08-NL
9V8H 1.39 Å, PPARgamma ligand-binding domain in complex with PG08-NL and rosiglitazone
8FKC 1.42 Å, Crystal structure of PPARgamma ligand-binding domain in complex with N-CoR peptide and…
6MS7 1.43 Å, Peroxisome proliferator-activated receptor gamma ligand binding domain in complex with a…
9V8D 1.44 Å, PPARgamma ligand-binding domain in complex with PG08
3U9Q 1.52 Å, Ligand binding domain of PPARgamma complexed with Decanoic Acid and PGC-1a peptide
8B94 1.55 Å, Crystal structure of PPARG and NCOR2 with BAY-5516, an inverse agonist
8DKV 1.59 Å, PPARg bound to JTP-426467 and Co-R peptide
3B1M 1.6 Å, Crystal structure of the PPARgamma-LBD complexed with a cercosporamide derivative…
3V9V 1.6 Å, Crystal structure of the PPARgamma-LBD complexed with a cercosporamide derivative…

Browse structure collections

About this viewer

MolViewer shows 6T1S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.