6TG6: Toprim domain of RNase M5

Toprim domain of RNase M5. Determined by X-ray diffraction at 1.3 Å resolution. Released 23 Sept 2020.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Geobacillus stearothermophilus
Chains: 1
Atoms: 1,033
Mol. weight: 12.53 kDa
Released: 23 Sept 2020

Explore 6TG6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TG6 contains 6 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
β-strand	6-9	4	2
α-helix	12-19	8
β-strand	23	1	1
β-strand	26-28	3	2
α-helix	36-49	14
β-strand	51-53	3	2
α-helix	59-71	13
β-strand	76-77	2	2
α-helix	82-85	4
α-helix	95-97	3
α-helix	100-108	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribonuclease M5	A	protein	116	Geobacillus stearothermophilus	A0A087LGV4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6TG6_1 Ribonuclease M5 (chains A)
GGSMKIKEVIVVEGKDDTAAIRRAVDADTIETNGAAVGAEVIERIKLAKERRGVIIFTDP
DFPGEKIRRTIAEQVPGCKHAFLPREAAKARSGKGIGVEHASPDDIRQALANVYEE

Primary citation

Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs. Oerum, S., Dendooven, T., Catala, M. et al. Mol Cell (2020) 80:227. DOI 10.1016/j.molcel.2020.09.008 · PubMed

Other PDB entries of the same protein (UniProt A0A087LGV4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TGJ 1.5 Å, RNA-binding domain of RNase M5
6Z2B 2.14 Å, Toprim domain of RNase M5 bound with two Mg2+ ions
6TPQ 3.07 Å, RNase M5 bound to 50S ribosome with precursor 5S rRNA

Browse structure collections

About this viewer

MolViewer shows 6TG6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.