6TGJ: RNA-binding domain of RNase M5

RNA-binding domain of RNase M5. Determined by X-ray diffraction at 1.5 Å resolution. Released 30 Sept 2020.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Geobacillus stearothermophilus
Chains: 2
Atoms: 1,287
Mol. weight: 20.47 kDa
Released: 30 Sept 2020

Explore 6TGJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TGJ contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	123-128	6
α-helix	135-148	14
α-helix	155-164	10
α-helix	169-183	15

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	120-122	3
α-helix	123-128	6
α-helix	135-148	14
α-helix	155-164	10
α-helix	169-184	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribonuclease M5	A, B	protein	90	Geobacillus stearothermophilus	A0A087LGV4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6TGJ_1 Ribonuclease M5 (chains A, B)
GGSMKIKQALANVYEETADWEEEITFAELIEAGLVGGEMARRRRQRLGEELKIGYANGRQ
FHKRLKVFRISRDAFYAALAQVMREEAGDA

Primary citation

Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs. Oerum, S., Dendooven, T., Catala, M. et al. Mol Cell (2020) 80:227. DOI 10.1016/j.molcel.2020.09.008 · PubMed

Other PDB entries of the same protein (UniProt A0A087LGV4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TG6 1.3 Å, Toprim domain of RNase M5
6Z2B 2.14 Å, Toprim domain of RNase M5 bound with two Mg2+ ions
6TPQ 3.07 Å, RNase M5 bound to 50S ribosome with precursor 5S rRNA

Browse structure collections

About this viewer

MolViewer shows 6TGJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.