Toprim domain of RNase M5. Determined by X-ray diffraction at 1.3 Å resolution. Released 23 Sept 2020.
Explore 6TG6 in 3D Show helices and sheets RCSB PDB PDBe
6TG6 contains 6 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2 | 1 | 1 |
| β-strand | 6-9 | 4 | 2 |
| α-helix | 12-19 | 8 | |
| β-strand | 23 | 1 | 1 |
| β-strand | 26-28 | 3 | 2 |
| α-helix | 36-49 | 14 | |
| β-strand | 51-53 | 3 | 2 |
| α-helix | 59-71 | 13 | |
| β-strand | 76-77 | 2 | 2 |
| α-helix | 82-85 | 4 | |
| α-helix | 95-97 | 3 | |
| α-helix | 100-108 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ribonuclease M5 | A | protein | 116 | Geobacillus stearothermophilus | A0A087LGV4 (AlphaFold model) |
>6TG6_1 Ribonuclease M5 (chains A) GGSMKIKEVIVVEGKDDTAAIRRAVDADTIETNGAAVGAEVIERIKLAKERRGVIIFTDP DFPGEKIRRTIAEQVPGCKHAFLPREAAKARSGKGIGVEHASPDDIRQALANVYEE
Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs. Oerum, S., Dendooven, T., Catala, M. et al. Mol Cell (2020) 80:227. DOI 10.1016/j.molcel.2020.09.008 · PubMed
Other PDB entries of the same protein (UniProt A0A087LGV4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6TG6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.