6TJ3: PfELC

P. falciparum essential light chain, N-terminal domain. Determined by solution NMR. Released 28 Oct 2020.

Method: Solution NMR
Organism: Plasmodium falciparum 3D7
Chains: 1
Atoms: 628
Mol. weight: 8.93 kDa
Released: 28 Oct 2020

Explore 6TJ3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TJ3 contains 4 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-17	16
β-strand	22-23	2	1
α-helix	25-33	9
α-helix	41-44	4
β-strand	51-52	2	1
α-helix	53-63	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PfELC	A	protein	74	Plasmodium falciparum 3D7	Q8IJM4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6TJ3_1 PfELC (chains A)
MASDMEEKFREAFILFSSCSDHIEMYKFFELMNSFGIILTNDEKAALPNDINMDYWLNFA
KKHYNYEQPFKHIN

Primary citation

Structural role of essential light chains in the apicomplexan glideosome. Pazicky, S., Dhamotharan, K., Kaszuba, K. et al. Commun Biol (2020) 3:568-568. DOI 10.1038/s42003-020-01283-8 · PubMed

Other PDB entries of the same protein (UniProt Q8IJM4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TJ4 1.5 Å, P. falciparum essential light chain, N-terminal domain
8A12 2.03 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to Mg.ATP-gamma-S
8CDQ 2.21 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to the inhibitor…
8CDM 2.35 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to the inhibitor…
9T7I 2.35 Å, Plasmodium falciparum Myosin A full-length, post-rigor state, complexed to the inhibitor…
6ZN3 2.51 Å, Plasmodium facliparum glideosome trimeric sub-complex
6YCY 2.55 Å, Plasmodium falciparum Myosin A full-length, post-rigor state
6YCZ 3.27 Å, Plasmodium falciparum Myosin A delta-Nter, Post-Rigor state
6YCX 3.99 Å, Plasmodium falciparum Myosin A full-length, pre-powerstroke state

Browse structure collections

About this viewer

MolViewer shows 6TJ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.