6TPK: Human oxytocin receptor

Crystal structure of the human oxytocin receptor. Determined by X-ray diffraction at 3.2 Å resolution. Released 5 Aug 2020.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,718
Mol. weight: 57.15 kDa
Ligands: NU2, CLR
Released: 5 Aug 2020

Explore 6TPK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TPK contains 23 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	36-63	28
α-helix	74-88	15
α-helix	89-93	5
α-helix	94-101	8
α-helix	109-142	34
α-helix	150-174	25
β-strand	175-179	5	1
β-strand	185-189	5	1
α-helix	196-205	10
α-helix	206-210	5
α-helix	211-228	18
α-helix	268-298	31
α-helix	307-332	26
α-helix	334-336	3
α-helix	349-351	3
α-helix	356-366	11
β-strand	373-378	6	2
α-helix	388-399	12
α-helix	404-406	3
β-strand	407-412	6	2
α-helix	417-429	13
β-strand	433-436	4	2
α-helix	442-451	10
β-strand	454-457	4	2
α-helix	466-473	8
α-helix	476	1
β-strand	477-481	5	2
α-helix	485-489	5
β-strand	496-498	3	2
α-helix	503-516	14
α-helix	522-534	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Oxytocin receptor	A	protein	502	Homo sapiens	P30559 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6TPK_1 Oxytocin receptor (chains A)
NEALARVEVAVLCLILLLALSGNACVLLALHTTRQKHSRLFFFMKHLSIADLVVAVFQVL
PQLLWDITFRFYGPDLLCRLVKYLQLVGMFASTYLLLLMSLDRCLAICQPLRSLRRRTAR
LAVLATWLGCLVVSAPQVHIFSLREVADGVFDCWAVFIRPWGPKAYITWITLAVYIVPVI
VLATCYGLIAFKIWQNLRLKTAAAAAAEAPEGAAAGDGGRVALARVSSVKLISKAKIRTV
KMTFIIVLAFIVCWTPFFFVQMWSVWDANAPKEASAFIIVMLLASLNCCCKPWIYMLFMG
HLFHGIDCSFWCCNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKA
IEILSSKKEFQEMRFIIIGKGDPELEGWARSLEEKHGNVKVITEMLSREFVRELYGSVDF
VIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKAL
ELSRSDLSKFRENCKKRAMSFS

Ligands and cofactors

ID	Name	Formula	Copies
NU2	(3~{R},6~{R})-6-[(2~{S})-butan-2-yl]-3-(2,3-dihydro-1~{H}-inden-2-yl)-1-[(1~{R}…	C27 H34 N4 O5	1
CLR	Cholesterol	C27 H46 O	1

Water and common crystallization additives (PEG) are not listed.

Primary citation

Crystal structure of the human oxytocin receptor. Waltenspuhl, Y., Schoppe, J., Ehrenmann, J. et al. Sci Adv (2020) 6:eabb5419-eabb5419. DOI 10.1126/sciadv.abb5419 · PubMed

Other PDB entries of the same protein (UniProt P30559 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RYC 2.9 Å, Oxytocin receptor (OTR) bound to oxytocin in complex with a heterotrimeric Gq protein
7QVM 3.25 Å, Human Oxytocin receptor (OTR) oxytocin Gq chimera (mGoqi) complex

Browse more

6TPK is part of these collections:

Insulin and hormones

About this viewer

MolViewer shows 6TPK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.