6TQQ: 16L protein

Name: PDB 6TQQ: Structural insight into tanapoxvirus mediated inhibition of apoptosis
Published: 2020-06-03
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

Structural insight into tanapoxvirus mediated inhibition of apoptosis. Determined by X-ray diffraction at 3.0 Å resolution. Released 3 Jun 2020.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Yaba-like disease virus, Homo sapiens
Chains: 2
Atoms: 1,308
Mol. weight: 20.74 kDa
Released: 3 Jun 2020

Explore 6TQQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TQQ contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	9-28	20
α-helix	33-52	20
α-helix	54-63	10
α-helix	66-68	3
α-helix	71-86	16
α-helix	91-108	18
α-helix	115-129	15
α-helix	132-140	9

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	151-170	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
16L protein	A	protein	152	Yaba-like disease virus	Q9DHU6 (AlphaFold model)
Bcl-2-like protein 11	B	protein	26	Homo sapiens	O43521 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6TQQ_1 16L protein (chains A)
GPLGSMENSCNFNNSIKNVIVFYINEKALIEEKKMLSCYENKLLNLIKEDCENIMLKYKP
NLSYICSLLKVDDTSEENIKHIKDQIIESLENDNRPSVKLAIISLISMIVEMNGYKGKNI
PMSFLIEDIALKISENSEDLINFINIKNKQKS

Sequence of entity 2 (B), FASTA

>6TQQ_2 Bcl-2-like protein 11 (chains B)
DMRPEIWIAQELRRIGDEFNAYYARR

Primary citation

Structural insight into tanapoxvirus-mediated inhibition of apoptosis. Suraweera, C.D., Anasir, M.I., Chugh, S. et al. FEBS J (2020) 287:3733-3750. DOI 10.1111/febs.15365 · PubMed

Other PDB entries of the same protein (UniProt Q9DHU6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TQP 1.85 Å, Structural insight into tanapoxvirus mediated inhibition of apoptosis
6TRR 2.12 Å, Structural insight into tanapoxvirus mediated inhibition of apoptosis

Browse structure collections

About this viewer

MolViewer shows 6TQQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.