6TUN: Helicase domain complex

Helicase domain complex. Determined by X-ray diffraction at 2.07 Å resolution. Released 11 Nov 2020.

Method: X-ray diffraction
Resolution: 2.07 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,125
Mol. weight: 63.76 kDa
Released: 11 Nov 2020

Explore 6TUN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TUN contains 26 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	249-252	4	1
α-helix	253-276	24
α-helix	278-290	13
α-helix	317-320	4
α-helix	326-343	18
β-strand	350-352	3	1
α-helix	354-365	12
α-helix	369-372	4
α-helix	375-385	11
α-helix	392-394	3
α-helix	395-409	15
β-strand	414-419	6	2
β-strand	432-437	6	2

Chain B: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	249-252	4	2
α-helix	253-276	24
α-helix	279-289	11
α-helix	317-320	4
α-helix	321-323	3
α-helix	326-343	18
β-strand	350-352	3	2
α-helix	354-365	12
α-helix	369-373	5
α-helix	375-385	11
α-helix	395-409	15
β-strand	414-419	6	1
β-strand	432-437	6	1

Chains C and D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	68-81	14
α-helix	86-88	3
α-helix	92-110	19
α-helix	115-128	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
General transcription and DNA repair factor IIH helicase subunit XPD	A, B	protein	197	Homo sapiens	P18074 (AlphaFold model)
CDK-activating kinase assembly factor MAT1	C, D	protein	77	Homo sapiens	P51948 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6TUN_1 General transcription and DNA repair factor IIH helicase subunit XPD (chains A, B)
GPDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETD
AHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLA
QRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGFTIIIEPFD
DRTPTIANPILHFSCMD

Sequence of entity 2 (C, D), FASTA

>6TUN_2 CDK-activating kinase assembly factor MAT1 (chains C, D)
GPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEI
YQKENKDVIQKNKLKLT

Primary citation

In TFIIH the Arch domain of XPD is mechanistically essential for transcription and DNA repair. Peissert, S., Sauer, F., Grabarczyk, D.B. et al. Nat Commun (2020) 11:1667-1667. DOI 10.1038/s41467-020-15241-9 · PubMed

Other PDB entries of the same protein (UniProt P18074 (AlphaFold model), which also has an AlphaFold model), best resolution first:

28JM 3.29 Å, Cryo-EM structure of the human holo-TFIIH and XPC initial encounter complex
7EGB 3.3 Å, TFIID-based holo PIC on SCP promoter
8EBU 3.3 Å, XPC release from Core7-XPA-DNA (Cy5)
9PD3 3.3 Å, NER dual incision complex - DuIS
28JS 3.32 Å, Cryo-EM structure of the human holo-TFIIH-XPC complex bound to bulky lesion-mimic DNA…
9PD4 3.4 Å, NER dual incision complex - DuIM
6RO4 3.5 Å, Structure of the core TFIIH-XPA-DNA complex
7AD8 3.5 Å, Core TFIIH-XPA-DNA complex with modelled p62 subunit
9XYU 3.5 Å, NER complex - C7CAD.ATP
28KE 3.6 Å, Cryo-EM structure of the human holo-TFIIH-XPC-XPA complex bound to bulky lesion-mimic DNA
8EBX 3.6 Å, XPA repositioning Core7 of TFIIH relative to XPC-DNA lesion (AP)
8EBY 3.6 Å, XPC release from Core7-XPA-DNA (AP)

Browse structure collections

About this viewer

MolViewer shows 6TUN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.