6TWX: MAGI1_2

MAGI1_2 complexed with a phosphorylated 16E6 peptide. Determined by X-ray diffraction at 2.3 Å resolution. Released 1 Apr 2020.

Method: X-ray diffraction
Resolution: 2.3 Å
Organisms: Homo sapiens, Human papillomavirus type 16
Chains: 4
Atoms: 6,920
Mol. weight: 100.03 kDa
Ligands: CA, CIT
Released: 1 Apr 2020

Explore 6TWX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TWX contains 47 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	463-465	3
β-strand	469-476	8	1
β-strand	478	1	2
β-strand	481	1	2
β-strand	484-488	5	1
β-strand	496-501	6	1
α-helix	506-510	5
β-strand	518-522	5	1
β-strand	526	1	1
α-helix	532-541	10
β-strand	547-554	8	1
α-helix	574-585	12
α-helix	592-599	8
α-helix	604-618	15
α-helix	622-629	8
α-helix	632-642	11
α-helix	645-655	11
α-helix	664-673	10
α-helix	676-690	15
α-helix	694-701	8
α-helix	704-714	11
α-helix	718-720	3
α-helix	727-739	13
α-helix	749-758	10
α-helix	761-774	14
α-helix	779-786	8
α-helix	789-803	15
α-helix	805-817	13
α-helix	824-834	11
α-helix	839-850	12
α-helix	854-861	8
α-helix	864-874	11

Chain B: 23 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	469-476	8	3
β-strand	478	1	4
β-strand	481	1	4
β-strand	484	1	3
β-strand	485	1	5
β-strand	486-488	3	3
β-strand	496-501	6	3
α-helix	506-510	5
β-strand	518-522	5	3
β-strand	525-526	2	3
α-helix	532-541	10
α-helix	543	1
β-strand	547-554	8	3
α-helix	574-586	13
α-helix	592-599	8
α-helix	604-618	15
α-helix	622-629	8
α-helix	632-642	11
α-helix	645-656	12
α-helix	664-673	10
α-helix	676-690	15
α-helix	694-701	8
α-helix	704-714	11
α-helix	718-722	5
α-helix	727-740	14
α-helix	749-758	10
α-helix	761-771	11
α-helix	779-786	8
α-helix	789-817	29
α-helix	824-833	10
α-helix	839-850	12
α-helix	854-861	8
α-helix	864-874	11

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	157	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1,Annexin A2	A, B	protein	427	Homo sapiens	P07355 (AlphaFold model), Q96QZ7 (AlphaFold model)
16E6 peptide	C, D	protein	10	Human papillomavirus type 16	P03126 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6TWX_1 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1,Annexin A2 (chains A, B)
GSMGKPFFTRNPSELKGKFIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDG
KMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCRGYPLGSSAYGSVKAYTN
FDAERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALS
GHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYK
TDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPK
WISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFAD
RLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALL
YLCGGDD

Sequence of entity 2 (C, D), FASTA

>6TWX_2 16E6 peptide (chains C, D)
SSRTRRETQL

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	11
CIT	Citric acid	C6 H8 O7	3

Water and common crystallization additives (GOL) are not listed.

Primary citation

Dual Specificity PDZ- and 14-3-3-Binding Motifs: A Structural and Interactomics Study. Gogl, G., Jane, P., Caillet-Saguy, C. et al. Structure (2020) 28:747-759.e3. DOI 10.1016/j.str.2020.03.010 · PubMed

Other PDB entries of the same protein (UniProt P07355 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HYV 1.42 Å, Human Annexin A2 with heparin hexasaccharide bound
1W7B 1.52 Å, Annexin A2: Does it induce membrane aggregation by a new multimeric state of the protein.
7QQM 1.6 Å, The PDZ domain of LRRC7 fused with ANXA2
7PC5 1.7 Å, The third PDZ domain of PDZD7 complexed with the PDZ-binding motif of EXOC4
7P73 1.85 Å, The PDZ domain of SYNJ2BP complexed with the PDZ-binding motif of HTLV1-TAX1
2HYU 1.86 Å, Human Annexin A2 with heparin tetrasaccharide bound
7ZVN 1.87 Å, Crystal structure of human Annexin A2 in complex with full phosphorothioate 5-10…
5LPX 1.9 Å, Crystal structure of PKC phosphorylation-mimicking mutant (S26E) Annexin A2
7P74 1.9 Å, The PDZ domain of SYNJ2BP complexed with the phosphorylated PDZ-binding motif of RSK1
7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
7P70 2.0 Å, The PDZ-domain of SNTB1 complexed with the PDZ-binding motif of HPV35-E6
7PCB 2.0 Å, The PDZ domain of SNX27 fused with ANXA2

Browse structure collections

About this viewer

MolViewer shows 6TWX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.