Crystal structure of human FKBP51 FK1 domain A19T mutant in complex with 4-methylimidazole. Determined by X-ray diffraction at 1.08 Å resolution. Released 27 May 2020.
Explore 6TX5 in 3D Show helices and sheets RCSB PDB PDBe
6TX5 contains 6 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 14-21 | 8 | |
| α-helix | 22 | 1 | |
| β-strand | 23-24 | 2 | 1 |
| β-strand | 33-39 | 7 | 1 |
| β-strand | 42 | 1 | 2 |
| β-strand | 52-61 | 10 | 1 |
| β-strand | 66-69 | 4 | 1 |
| α-helix | 71-73 | 3 | |
| β-strand | 77-80 | 4 | 1 |
| α-helix | 88-95 | 8 | |
| α-helix | 97-98 | 2 | |
| β-strand | 99 | 1 | 2 |
| β-strand | 102-107 | 6 | 1 |
| α-helix | 109-111 | 3 | |
| β-strand | 118 | 1 | 3 |
| β-strand | 122 | 1 | 3 |
| β-strand | 128-138 | 11 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peptidyl-prolyl cis-trans isomerase FKBP5 | A | protein | 128 | Homo sapiens | Q13451 (AlphaFold model) |
>6TX5_1 Peptidyl-prolyl cis-trans isomerase FKBP5 (chains A) GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHD RNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEI ELLDFKGE
| ID | Name | Formula | Copies |
|---|---|---|---|
| 4MZ | 4-methylimidazole | C4 H6 N2 | 1 |
Water and common crystallization additives (NA) are not listed.
Hybrid Screening Approach for Very Small Fragments: X-ray and Computational Screening on FKBP51. Draxler, S.W., Bauer, M., Eickmeier, C. et al. J Med Chem (2020) 63:5856-5864. DOI 10.1021/acs.jmedchem.0c00120 · PubMed
Other PDB entries of the same protein (UniProt Q13451 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6TX5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.