Structure of Ku80 von Willebrand domain S229A mutant complexed with XLF Ku Binding Motif. Determined by X-ray diffraction at 1.9 Å resolution. Released 27 Nov 2019.
Explore 6TYX in 3D Show helices and sheets RCSB PDB PDBe
6TYX contains 20 α-helices and 18 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-14 | 7 | 1 |
| α-helix | 17-20 | 4 | |
| α-helix | 23-25 | 3 | |
| α-helix | 29-47 | 19 | |
| β-strand | 52-58 | 7 | 1 |
| β-strand | 64 | 1 | 1 |
| β-strand | 69 | 1 | 2 |
| β-strand | 72 | 1 | 2 |
| β-strand | 76-83 | 8 | 1 |
| α-helix | 87-95 | 9 | |
| α-helix | 106-120 | 15 | |
| β-strand | 129-134 | 6 | 1 |
| α-helix | 143-145 | 3 | |
| α-helix | 146-156 | 11 | |
| β-strand | 158-164 | 7 | 1 |
| α-helix | 198-220 | 23 | |
| β-strand | 223-225 | 3 | 1 |
| α-helix | 226-233 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-14 | 7 | 3 |
| α-helix | 17-20 | 4 | |
| α-helix | 27-28 | 2 | |
| α-helix | 29-46 | 18 | |
| β-strand | 52-58 | 7 | 3 |
| β-strand | 64 | 1 | 3 |
| β-strand | 69 | 1 | 4 |
| β-strand | 72 | 1 | 4 |
| β-strand | 76-83 | 8 | 3 |
| α-helix | 87-95 | 9 | |
| α-helix | 106-120 | 15 | |
| β-strand | 129-134 | 6 | 3 |
| α-helix | 143-145 | 3 | |
| α-helix | 146-156 | 11 | |
| β-strand | 158-164 | 7 | 3 |
| α-helix | 198-220 | 23 | |
| β-strand | 223-225 | 3 | 3 |
| α-helix | 226-234 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 308-310 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| X-ray repair cross-complementing protein 5 | A, B | protein | 231 | Xenopus laevis | Q6DDS9 (AlphaFold model) |
| Lys-gly-leu-phe-met | C, D | protein | 18 | Xenopus laevis | A0A1L8ENT6 (AlphaFold model) |
>6TYX_1 X-ray repair cross-complementing protein 5 (chains A, B) MHHHHHHMARAAKSAVVLCMDVGLAMSHSNQGKESPFEQAKKVMMLFLQRQVFAESKDEI AVVLYGTDTTDNALAREDQYENISVHRHLMLPDFDLLEQIENVVEPGSVQADFLDALIVS MDLLQKETLGKKYTRLHIAVFSDLSSPFSVDQLEVIIANLKKAEITLQFFLPFSVDEGSG PGKGLSDQQKEGIEMVRKIMFSLDGEEGLSEVFTFRDALERLSIFKKIERR
>6TYX_2 LYS-GLY-LEU-PHE-MET (chains C, D) RPPAGASKPKKKAKGLFM
Ligand binding characteristics of the Ku80 von Willebrand domain. Kim, K., Min, J., Kirby, T.W. et al. DNA Repair (Amst) (2019) 85:102739-102739. DOI 10.1016/j.dnarep.2019.102739 · PubMed
Other PDB entries of the same protein (UniProt Q6DDS9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6TYX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.