6U1N: GPCR-Beta arrestin structure in lipid bilayer

GPCR-Beta arrestin structure in lipid bilayer. Determined by electron microscopy at 4.0 Å resolution. Released 26 Feb 2020.

Method: Electron microscopy
Resolution: 4.0 Å
Organisms: Homo sapiens, Rattus norvegicus
Chains: 4
Atoms: 5,863
Mol. weight: 151.02 kDa
Ligands: 2CU
Released: 26 Feb 2020

Explore 6U1N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6U1N contains 29 α-helices and 51 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 8 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
β-strand	18-22	5	1
β-strand	26	1	2
β-strand	29-30	2	3
β-strand	33-34	2	3
α-helix	35-36	2
β-strand	37-43	7	1
β-strand	52-62	11	4
β-strand	76-87	12	4
α-helix	99-107	9
β-strand	112-117	6	1
β-strand	128-129	2	5
β-strand	141-151	11	4
α-helix	160-162	3
β-strand	164-168	5	4
β-strand	169	1	2
α-helix	180-182	3
β-strand	183-188	6	6
β-strand	197-203	7	6
β-strand	207-209	3	7
α-helix	212-213	2
β-strand	214-221	8	6
β-strand	227-242	16	8
β-strand	246-258	13	8
β-strand	262	1	8
β-strand	267-274	8	6
α-helix	279-281	3
β-strand	288-289	2	5
β-strand	300	1	5
α-helix	301-303	3
α-helix	306-307	2
β-strand	317-330	14	8
β-strand	342-349	8	8
β-strand	350-352	3	7

Chain H: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	9
β-strand	14-15	2	10
β-strand	20-27	8	9
α-helix	32-34	3
β-strand	37-42	6	11
β-strand	48-55	8	11
α-helix	56-58	3
β-strand	60-63	4	11
α-helix	65-67	3
β-strand	72-76	5	9
β-strand	81-87	7	9
α-helix	91-93	3
β-strand	95-101	7	11
β-strand	112-113	2	11
β-strand	117-119	3	11
β-strand	120-121	2	10

Chain L: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	12
β-strand	12-14	3	13
β-strand	20-26	7	12
β-strand	34-39	6	14
α-helix	44-45	2
β-strand	46-50	5	14
β-strand	54-55	2	14
α-helix	56	1
β-strand	64-68	5	12
β-strand	71-76	6	12
α-helix	81-83	3
β-strand	86-91	6	14
β-strand	99	1	14
β-strand	103-104	2	14
β-strand	105-107	3	13

Chain R: 14 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	21-47	27
α-helix	57-71	15
α-helix	72-76	5
α-helix	77-86	10
α-helix	93-116	24
α-helix	120-126	7
α-helix	131-134	4
α-helix	137-166	30
α-helix	184-212	29
α-helix	383-413	31
α-helix	414-416	3
α-helix	419-430	12
α-helix	432-440	9
α-helix	445-451	7
β-strand	492-495	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Muscarinic acetylcholine receptor M2, Vasopressin V2 receptor chimera	R	protein	509	Homo sapiens	P08172 (AlphaFold model), P30518 (AlphaFold model)
Beta-arrestin-1	C	protein	401	Rattus norvegicus	P29066 (AlphaFold model)
Fab30 heavy chain	H	protein	237	Homo sapiens	V9HW68 (AlphaFold model)
Fab30 light chain	L	protein	215	Homo sapiens	Q7Z3Y4

Sequence of entity 1 (R), FASTA

>6U1N_1 Muscarinic acetylcholine receptor M2, Vasopressin V2 receptor chimera (chains R)
DYKDDDDKNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRH
LQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMN
LLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVED
GECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSP
SLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVA
SNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQN
GDEKQNIVARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFC
APCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATRLPETGGG
ARGRTPPSLGPQDESCTTASSSLAKDTSS

Sequence of entity 2 (C), FASTA

>6U1N_2 Beta-arrestin-1 (chains C)
GSPEFPGRLGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERR
VYVTLTVAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHA
YPFTFEIPPNLPSSVTLQPGPEDTGKALGVDYEVKAFVAENLEEKIHKRNSVRLVIRKVQ
YAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIK
ISVRQYADIVLFNTAQYKVPVAMEEADDTVAPSSTFSKVYTLTPFLANNREKRGLALDGK
LKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLM
HPKPKEEPPHREVPESETPVDTNLIELDTNDDDIVFEDFAR

Sequence of entity 3 (H), FASTA

>6U1N_3 Fab30 heavy chain (chains H)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHHH

Sequence of entity 4 (L), FASTA

>6U1N_4 Fab30 light chain (chains L)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Ligands and cofactors

ID	Name	Formula	Copies
2CU	3-amino-5-chloro-N-cyclopropyl-4-methyl-6-[2-(4-methylpiperazin-1-yl)-2-oxoetho…	C19 H24 Cl N5 O3 S	1

Primary citation

Structure of the M2 muscarinic receptor-beta-arrestin complex in a lipid nanodisc. Staus, D.P., Hu, H., Robertson, M.J. et al. Nature (2020) 579:297-302. DOI 10.1038/s41586-020-1954-0 · PubMed

Other PDB entries of the same protein (UniProt P08172 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ZKC 2.3 Å, Crystal structure of rationally thermostabilized M2 muscarinic acetylcholine receptor…
5YC8 2.5 Å, Crystal structure of rationally thermostabilized M2 muscarinic acetylcholine receptor…
5ZK3 2.6 Å, Crystal structure of rationally thermostabilized M2 muscarinic acetylcholine receptor…
8J8R 2.9 Å, Structure of beta-arrestin2 in complex with M2Rpp
5ZKB 2.95 Å, Crystal structure of rationally thermostabilized M2 muscarinic acetylcholine receptor…
3UON 3.0 Å, Structure of the human M2 muscarinic acetylcholine receptor bound to an antagonist
5ZK8 3.0 Å, Crystal structure of M2 muscarinic acetylcholine receptor bound with NMS
8JAF 3.1 Å, Structure of Muscarinic receptor (M2R) in complex with beta-arrestin1 (Local Refine,…
7T94 3.16 Å, Cryo-EM structure of S1 state ACh-bound M2R-Go signaling complex with a PAM
8J97 3.2 Å, Structure of Muscarinic receptor (M2R) in complex with beta-arrestin1 (Local refine,…
7T8X 3.21 Å, Cryo-EM structure of ACh-bound M2R-Go signaling complex in S1 state
7T96 3.22 Å, Cryo-EM structure of S2 state ACh-bound M2R-Go signaling complex with a PAM

Browse structure collections

About this viewer

MolViewer shows 6U1N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.