3UON: Human M2 muscarinic acetylcholine receptor

Structure of the human M2 muscarinic acetylcholine receptor bound to an antagonist. Determined by X-ray diffraction at 3.0 Å resolution. Released 1 Feb 2012.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Homo sapiens, Enterobacteria phage T4
Chains: 1
Atoms: 3,547
Mol. weight: 53.28 kDa
Ligands: QNB, BGC
Released: 1 Feb 2012

Explore 3UON in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UON contains 26 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	23-50	28
α-helix	52-54	3
α-helix	57-71	15
α-helix	72-76	5
α-helix	77-85	9
α-helix	93-126	34
α-helix	132-134	3
α-helix	137-166	30
α-helix	179-182	4
α-helix	184-191	8
α-helix	192-196	5
α-helix	197-213	17
α-helix	1003-1010	8
β-strand	1014-1015	2	1
β-strand	1016	1	2
β-strand	1017-1019	3	1
β-strand	1025-1028	4	1
β-strand	1031-1032	2	1
α-helix	1039-1050	12
β-strand	1057	1	2
α-helix	1060-1079	20
α-helix	1085-1090	6
α-helix	1093-1111	19
α-helix	1112-1114	3
α-helix	1115-1122	8
α-helix	1126-1133	8
α-helix	1137-1141	5
α-helix	1143-1155	13
α-helix	384-412	29
α-helix	419-431	13
α-helix	435-443	9
α-helix	445-454	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human M2 muscarinic acetylcholine, receptor T4 lysozyme fusion protein	A	protein	467	Homo sapiens, Enterobacteria phage T4	P00720, P08172 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3UON_1 Human M2 muscarinic acetylcholine, receptor T4 lysozyme fusion protein (chains A)
MDDSTDSSDNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRINIFEMLRIDEGLRLKIYKDTEGY
YTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKL
KPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPN
RAKRVITTFRTGTWDAYPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPN
TVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR

Ligands and cofactors

ID	Name	Formula	Copies
QNB	(3R)-1-azabicyclo[2.2.2]oct-3-yl hydroxy(diphenyl)acetate	C21 H23 N O3	1
BGC	beta-D-glucopyranose	C6 H12 O6	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Structure of the human M2 muscarinic acetylcholine receptor bound to an antagonist. Haga, K., Kruse, A.C., Asada, H. et al. Nature (2012) 482:547-551. DOI 10.1038/nature10753 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse more

3UON is part of these collections:

GPCRs and cell signaling

About this viewer

MolViewer shows 3UON directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.