1.7 angstrom structure of a pathogenic human Syt 1 C2B (D304G). Determined by X-ray diffraction at 1.7 Å resolution. Released 13 May 2020.
Explore 6U41 in 3D Show helices and sheets RCSB PDB PDBe
6U41 contains 6 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 276-284 | 9 | 1 |
| β-strand | 289-298 | 10 | 1 |
| α-helix | 300-302 | 3 | |
| β-strand | 311-319 | 9 | 2 |
| β-strand | 322-328 | 7 | 2 |
| α-helix | 329-332 | 4 | |
| β-strand | 339-347 | 9 | 1 |
| α-helix | 353-355 | 3 | |
| β-strand | 357-364 | 8 | 2 |
| α-helix | 370-371 | 2 | |
| β-strand | 372-380 | 9 | 2 |
| α-helix | 385-396 | 12 | |
| β-strand | 402-407 | 6 | 1 |
| β-strand | 409 | 1 | 2 |
| α-helix | 411-418 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Synaptotagmin-1 | A | protein | 157 | Homo sapiens | P21579 (AlphaFold model) |
>6U41_1 Synaptotagmin-1 (chains A) GDITHMEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMGVGGLSDPYVKIHLMQNGKRLK KKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTG AELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK
Molecular Basis for Synaptotagmin-1-Associated Neurodevelopmental Disorder. Bradberry, M.M., Courtney, N.A., Dominguez, M.J. et al. Neuron (2020) 107:52-64.e7. DOI 10.1016/j.neuron.2020.04.003 · PubMed
Other PDB entries of the same protein (UniProt P21579 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6U41 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.