7TUA: Human Synaptotagmin-1 C2B Y312F without Ca2+

Human Synaptotagmin-1 C2B Y312F without Ca2+. Determined by X-ray diffraction at 1.35 Å resolution. Released 22 Mar 2023.

Method: X-ray diffraction
Resolution: 1.35 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,484
Mol. weight: 17.96 kDa
Released: 22 Mar 2023

Explore 7TUA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TUA contains 6 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	276-284	9	1
β-strand	289-298	10	1
α-helix	300-302	3
β-strand	311-319	9	2
β-strand	322-328	7	2
α-helix	329-333	5
β-strand	339-347	9	1
α-helix	353-355	3
β-strand	357-364	8	2
α-helix	370-371	2
β-strand	372-380	9	2
α-helix	385-396	12
β-strand	402-407	6	1
β-strand	409	1	2
α-helix	411-418	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Synaptotagmin	A	protein	157	Homo sapiens	P21579 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7TUA_1 Synaptotagmin (chains A)
GDITHMEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPFVKIHLMQNGKRLK
KKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTG
AELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK

Primary citation

The AD3 locus of synaptotagmin-1 C2 domains modulates domain stability. Dominguez, M.J., Bui, A.A., Villarreal, J. et al. Biophys J (2024). DOI 10.1016/j.bpj.2024.11.009 · PubMed

Other PDB entries of the same protein (UniProt P21579 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TZ3 1.17 Å, Crystal Structure of Human Synaptotagmin 1 C2B without Ca2+
6U4U 1.3 Å, 1.3 A structure of a pathogenic human Syt 1 C2B (I368T)
3F04 1.35 Å, Crystal Structure of Synaptotagmin I C2A domain
3F00 1.36 Å, Crystal Structure of Synaptotagmin I C2A domain with Cu(II)
3F05 1.4 Å, Crystal Structure of Synaptotagmin I C2A domain with Mn(II)
6U4W 1.4 Å, 1.4 A structure of a pathogenic human Syt 1 C2B (D366E)
7U4Q 1.56 Å, Human Synaptotagmin-1 C2A Y181F Ca2+ bound
3F01 1.7 Å, Crystal Structure of Synaptotagmin I C2A domain with Cu(II)
6U41 1.7 Å, 1.7 angstrom structure of a pathogenic human Syt 1 C2B (D304G)
4V11 1.95 Å, Structure of Synaptotagmin-1 with SV2A peptide phosphorylated at Thr84
6G5K 2.0 Å, Crystal structure of the binding domain of Botulinum Neurotoxin type B in complex with…
6QNS 2.4 Å, Crystal structure of the binding domain of Botulinum Neurotoxin type B mutant…

Browse structure collections

About this viewer

MolViewer shows 7TUA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.